KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_36940Help
Entry
KPHS_36940        CDS       T01733                                 

Definition
(RefSeq) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00020  Citrate cycle (TCA cycle)
kpm00620  Pyruvate metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01200  Carbon metabolism
Module
kpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPHS_36940
   00620 Pyruvate metabolism
    KPHS_36940
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     KPHS_36940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-GeneID: 11848726
NCBI-ProteinID: YP_005227994
UniProt: A0A0H3GVK6
Position
complement(3718514..3720148)
Genome map
AA seq 544 aa AA seqDB search
MNKKMAVPRSQAVGPNSTRTNTRHEQETDVLLIGGGIMSATLGTWLQELEPDWSITMVEQ
MSSVAEESSNGWNNAGTGHAALMELNYTPQTANGINIDKAVDINEAFHISRQFWAHQVTR
GVLNKPKSFINSVPHMSFVWGEDNVNFLRARYAALQQSELFRGIRYSEDHQQIKAWAPLV
MEGRDPLQKVAATRSEVGTDVNYGEITRQLIAGLQKHDNFSLQLGTVVRRFKRNADKSWT
VTLADADNRRQKRVIKAKFIFIGAGGAALTLLQETGIPQAKEYAGFPVGGQFLVCENPEV
VNHHLAKVYGQAEVGAPPMSVPHIDTRIIDGKRVVLFGPFATFSTRFLKNGSLWDLLAST
NTSNILPMLNVGLDNFDLVKYLISQVMQKDKDRLAALCEYYPEARKEDWRLWQAGQRVQI
IKRDAKKGGVLRLGTEVVSDDEGTVAALLGASPGASTAAPIMLQLMEKVFKDKVNSPEWQ
AKLKAIIPTYGIRLDGNPAEIEKALAWTSEVLELKYEPAGAVDEVPQAELKPLSGGKPMA
DIAL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagatggccgtaccacgctcacaggcggttggtcccaacagcactcggacc
aacacccgccatgagcaagagacggatgtattgttgattggcggcggcattatgagcgcc
acactgggaacctggctgcaggagcttgagccagactggtctattaccatggttgagcag
atgtccagcgtggcggaagagagctcaaacgggtggaataatgcgggtaccggccacgcg
gcgctgatggagctgaactacacgccgcagaccgccaacggcatcaatatcgacaaagcg
gtcgacatcaacgaagccttccatatctcgcgtcagttctgggcgcatcaggtgacgcgc
ggcgtcctgaacaaaccaaaatctttcattaacagcgtgccgcacatgagctttgtgtgg
ggcgaagataacgtcaacttcctccgtgcgcgctacgcggcgctgcagcaaagtgaactg
ttccgcggtattcgctattctgaagaccatcagcagatcaaagcctgggcgccgctggtg
atggaaggccgcgacccgctgcaaaaggtcgccgccactcgctcagaagtgggaaccgac
gtcaactatggtgaaattacccgccagctgatcgccggtctgcaaaagcatgataatttc
tccctacagctgggcaccgtggtgcgtcgcttcaagcgcaacgccgacaagagctggacg
gtcaccctggcggatgccgacaatcgtcgtcagaagcgggtcattaaagctaaatttatc
tttatcggcgccggcggcgcagcgctgaccctgctgcaggagaccggcattccgcaggcc
aaagagtatgcgggcttcccggtcggcggccagttcctggtctgcgaaaatccggaggtg
gtgaaccaccatctggcgaaggtctacggtcaggccgaagtgggcgcgccgccgatgtcg
gtgccgcacatcgatacccgtattatcgacggtaaacgcgtggtgctgttcggaccattc
gccaccttctcgacccgtttcctgaagaacggttcgctgtgggatctgctggcctcgacg
aatacctcaaatattttgccaatgctcaacgtcggcctggacaacttcgatctggtaaaa
tatctgattagccaggtgatgcagaaagataaagatcgtctggccgcgctgtgcgaatat
tatccggaagcgcggaaagaggactggcggttgtggcaggccggtcagcgcgtgcagatc
attaagcgcgacgcgaagaagggcggggtactgcgcctgggcaccgaagtggtcagcgat
gatgaaggcaccgtcgcggcgcttctcggcgcgtcgccaggggcctccaccgcggcgcct
atcatgctgcagctaatggagaaagtgtttaaagataaagtcaattcgccggaatggcag
gccaagctgaaggcgatcatcccaacctacggtattcgtcttgacggcaacccggcggag
atcgagaaagcgctggcgtggaccagtgaagtgctggaactgaaatatgagccagccggg
gcggtggatgaggtgccgcaggcggagctgaagccgctgagcggcggcaagccgatggcg
gatatcgcgctctga

DBGET integrated database retrieval system