KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_43260Help
Entry
KPHS_43260        CDS       T01733                                 

Definition
(RefSeq) glycoside hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00052  Galactose metabolism
kpm00500  Starch and sucrose metabolism
kpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPHS_43260
   00500 Starch and sucrose metabolism
    KPHS_43260
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPHS_43260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 11849377
NCBI-ProteinID: YP_005228626
UniProt: A0A0H3H2E4
Position
complement(4362981..4364414)
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAREGD
TGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFSN
RNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgcttaat
ctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgacccaaac
ggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccgtactccacc
cagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggagcat
ttgccggtagccctggcgccggagggcccggaggataaagacggctgcttttccggctcg
gcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgtgac
ccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggggtg
ctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcaccctc
aacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagcaac
cgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgttttatt
cgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagcttc
tccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctgagc
gcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgcgag
gcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggtctg
cgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctggtgctggaa
cggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgacggc
gaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaattagcgttattt
gcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system