KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_44910
Entry
KPHS_44910        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-GeneID: 11849544
NCBI-ProteinID: YP_005228791
UniProt: A0A0H3H2Z1
Position
complement(4520546..4520941)
AA seq 131 aa
MQRLLIIIASLVLAGQACADVVLYTDRHHPPLDNDPQVTVVWLDAPDTAQQQIFGNLALE
PDKAERQAKVLPQSPNWARQQARIVDAWQGVLKAWQLDIRKVPAVVFDDRDVVYGTTDIQ
RAAALRAGSRP
NT seq 396 nt   +upstreamnt  +downstreamnt
atgcaacgactactcatcataattgcatcactggtgctggccgggcaggcctgtgccgac
gtggttttgtacaccgaccgccatcaccctccgctagataacgatccgcaggtcacggtg
gtctggctggatgcgccggacacggcgcagcagcagattttcggcaatctggcgcttgag
cccgacaaagcggagcggcaggcaaaggtgttgcctcagtcgccgaactgggcacgtcag
caggcgcggatcgtcgatgcctggcagggcgtactgaaggcctggcaactggacattcgc
aaggtgcccgccgtggtgtttgacgatcgcgatgtggtgtacggcaccacggatattcag
cgtgcggcggcgctgcgcgcagggagcaggccatga

DBGET integrated database retrieval system