KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_45000
Entry
KPHS_45000        CDS       T01733                                 
Name
(RefSeq) hypothetical protein
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF87 HerA_C FtsK_SpoIIIE AAA_10 AAA_22 Pox_A32 TrwB_AAD_bind T2SSE AAA_29 ABC_tran ATPase_2 AAA_16 AIG1
Other DBs
NCBI-GeneID: 11849553
NCBI-ProteinID: YP_005228800
UniProt: A0A0H3GVH7
Position
complement(4528941..4531718)
AA seq 925 aa
MMFSLFTREKAAAPVPQAEEKAVLKPSLRKSGKLKISDEQARYHREPPLIDYLPWVEYLP
SSQSILLDDGVSVGAVFDVLPVGSEGRTAERLEEIRDVIEDAIQDSFDERDTCPWVIQFF
CQDETDVTAYLDRLRGYIKPWAQGSAFTEDYLREIEGHMRGIAVPQGLFIDKTVTGAPWR
GQQRRTRMVVYRYVDPAQRDPYSPETALSQVCERLVSALNGAGVVAERQSGEQIHAWLLR
WFNPDPQWVEKEVLYRTARHHDNPHNALPLMTDFSESLWFTPPRSDAENGVWWFDEQPHR
AVTIDRLRRPPAVGHLTGETRKGDNINALMDLMPEGTVMCMTIVVQAQDVLEERFTHLAK
NAIGENVESSRVREDAAIAKSFLGERHKLYHGSMTFLLTAPDLPQLQSRQRELNAVLLNA
GLQPTRGEYEVAPLNGYLRAMPMCFNPARDKHHWYTRLTFVQHLANLSPLFGRDTGTGNP
GFTFFNRGGAPLTFDPLNSNDRTKNAHMAIFGPTGSGKSATLNSLFSQLMAIHRPRLFIA
EAGNSFGLFADYCGELGLTVNKISIKPGCGISLAPFADAHKLIEQPVVPVSESELSDGID
IDDVDGEEDGDEERDILGELEIAARLMITGGEEKEEARLERADRGMMREAILAAAQQAWD
EGRQMITGDLQSAFYQFARDPARPAERQVRAQNMGESLGVFMQGFLGELFNRPGENWPEA
DVTLIDLGTLAREGYEAPLAVAYISLVNTINNLAERDQFDDREIVFATDEAHMITTNPLL
APYVVKVVKMWRKLGAWLWLATQNLDDFPNAAKKMLNMIEWWLCLVMPPEEVEQIARFKK
LTEEQKAMLLSANKAKHCYTEGVVLASRIEALFRAVPPSLYLALGMTEKEEKAQRRALMN
EYGISELGAAKRVARQMDELRGILR
NT seq 2778 nt   +upstreamnt  +downstreamnt
gtgatgtttagcctgtttacgcgtgaaaaggcggcggcacctgtgccgcaggctgaagag
aaggcggtactcaaaccgtcgttgaggaaatcgggcaagctgaaaatctcggatgagcaa
gcgcgctaccatcgtgaaccgccattgattgactacttgccctgggttgaatatctgccg
tccagccagagcattttgctggatgacggcgtgtcggtgggcgcggtgttcgacgtgctg
ccggtcggttcggaagggcgtacggcggagcgcctggaggagatccgtgacgtcattgaa
gacgccattcaggacagctttgacgagcgggatacttgcccgtgggtgatccagttcttc
tgtcaggatgaaacagacgtcaccgcctatctggacaggctgcgcggttacatcaagccc
tgggcgcaggggagcgccttcaccgaggactacctgcgggagattgaaggccacatgcgc
gggatcgccgtaccgcaagggctgtttattgataagaccgtcaccggcgcgccgtggcgt
ggtcagcagcggcgtacccgcatggtggtctatcgctatgtcgaccccgcccagcgcgat
ccgtattcacccgaaacggcgctgagtcaggtgtgcgagcggctggtttccgccctgaac
ggcgcgggcgtggtggcggaacgccagagtggggagcagatccacgcctggctgctgcgc
tggtttaaccccgacccgcagtgggtggaaaaggaggtgctctaccgcaccgcccgccat
cacgacaacccacataacgcactgccgctgatgaccgacttcagcgaatccttatggttt
acgccgccgcgctcggatgcggaaaacggcgtctggtggtttgacgaacagcctcaccgg
gcggtaactatcgatcgcctgcgtcgcccccctgcggtgggacatctgaccggggagacc
cgcaagggtgacaacatcaatgccctgatggacctcatgccggaaggcaccgtgatgtgc
atgaccattgtggtgcaggcacaggacgtgctggaagagcgttttacccatctggcaaaa
aacgcgattggcgaaaacgtggaatcgtcccgggtgcgggaagatgcggccattgccaag
tcgtttctgggcgagcggcacaagctctatcacggcagcatgacgtttttgctaacggct
ccggatctgccgcagctccagtcgcgccagcgcgagctgaacgcagtattgctgaacgcc
ggtttacagcccacccggggcgaatacgaggttgcgccgctgaatgggtacctgcgcgcc
atgccgatgtgctttaacccggcccgggataagcaccattggtatacccgcctgaccttt
gtccagcatctggcgaacctgtcaccgctgttcgggcgggataccggcaccggcaacccg
ggattcaccttctttaatcgcggcggcgcgccgctcacgttcgatccgctgaacagcaat
gaccgtaccaagaacgcccatatggcgattttcgggccgacgggctccggcaagtcggcc
acgctcaacagcctgttttcccagttaatggcgatccaccggccccggttgttcatcgct
gaagccgggaacagctttggcctgtttgccgattactgcggtgagctggggctgacggtg
aacaaaatcagcatcaagccgggctgcgggatttctctggccccgtttgctgatgcgcac
aagctgattgagcagccggtggtccccgtcagtgaaagcgagcttagcgacggcattgat
attgacgacgttgacggtgaagaggacggcgacgaggagcgcgacattctgggggagctg
gagatcgccgcccgcctgatgatcaccggtggggaggagaaggaagaggccaggctggaa
cgcgccgatcgcggcatgatgcgtgaggccattctggcggcggcgcaacaggcctgggac
gaaggcaggcagatgatcaccggcgaccttcagtcggcgttttatcagtttgcccgcgat
cccgcccgccccgccgaacggcaggtacgcgctcagaatatgggggagtcgctcggcgtg
tttatgcagggctttctgggtgagctgtttaatcgcccgggcgagaactggccggaagcg
gacgtgacgctgattgacctcggcacgctggcgcgtgaaggctatgaagcgccgctggcg
gtagcctatatttcgctggtgaacaccatcaataatctggcggaacgcgatcagttcgac
gatcgggaaatcgtgttcgccaccgatgaggcccatatgatcaccaccaacccgttgctg
gctccctacgtggtgaaggtggtcaagatgtggcgaaagctgggagcatggctttggctg
gcgacgcagaaccttgatgacttccccaatgcggcgaaaaagatgctcaacatgatcgag
tggtggctgtgcctggtgatgccgccggaagaggtggagcagatagcgcgctttaaaaag
ctgacggaggagcagaaggccatgctgctgtcggccaataaagcgaagcactgctatacc
gagggtgtggtgctcgccagccggattgaggcgctgtttcgcgccgtgccgcccagcctg
tatctggcgctggggatgacggagaaagaggagaaggcgcagcgcagggcgttgatgaat
gaatacggtattagcgagttgggggccgcgaagcgggttgcccggcagatggatgaattg
cgggggatccttcgctag

DBGET integrated database retrieval system