KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_45040Help
Entry
KPHS_45040        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2895 TMEM190 TpcC
Motif
Other DBs
NCBI-GeneID: 11849557
NCBI-ProteinID: YP_005228804
UniProt: A0A0H3GXM0
Position
complement(4534453..4535106)
Genome map
AA seq 217 aa AA seqDB search
MSRFKNALNARDAHIWTLRGTCVLLILVCLVLALGWMNAPRNLTIHQPPDLRSGSTRPWW
EVPPSTVYAFGFYVFQQLNSWPKDGEQDYPARIKSLSPYLTPECQTLLEDDARKRNFSGE
LRERVRGIYEIPGRGYRGDRVEIVDRDHWVIRLDLTADEYYHNEPVKRALVRYPLKVVRW
DVNPELNPFGLALDCFAAMPQRLEAAPVDVPEKKGIF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtttcaaaaatgcccttaacgcccgcgatgcgcatatctggacgctgcgcgga
acctgcgttttgctgattctggtgtgcctggtgctggccctgggctggatgaacgcgccg
cgcaacctcactatccatcagccgccggacctgcgcagcggcagcacccgcccctggtgg
gaagtgccgcccagcacggtatacgcgtttggcttctacgtatttcagcagttgaacagt
tggccgaaggatggtgaacaggattatccggccagaattaagtctctttccccttacctg
accccggaatgccagacgttactggaggacgacgcgcgcaagcgcaacttctccggcgaa
ctgcgcgagcgggtgcgcggtatctatgaaatccccggacgaggttaccgcggcgatcgg
gtggagattgtcgatcgcgaccattgggttatccggctcgacctcaccgccgatgagtat
taccacaacgaaccggtcaaacgcgcgttagttcgctatccgctgaaggtggtgcgctgg
gacgtcaatccggaactgaacccgtttggcctggcgctggactgctttgccgcgatgccg
cagcgcctggaagccgccccggtcgatgtgcctgagaagaaggggatattttga

DBGET integrated database retrieval system