KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_45130
Entry
KPHS_45130        CDS       T01733                                 
Name
(RefSeq) TraG-family protein
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 11849566
NCBI-ProteinID: YP_005228813
UniProt: A0A0H3GYF5
Position
complement(4539381..4541480)
AA seq 699 aa
MSDRYVIEALLRPAVELNTAVVSACASYVCVTAPWAIALAPSVSYVMAGALGIFAIKRTR
EGLRVLRYRRNIRRLPRYVMTSRQVPVSQMKLFLGKGFLWEQRHTQRLLDTLRPEVARYV
NPSWVYQAARRVEQRQEYRFPTLCRLLASESAFNPVRPLPPVGGLPALHGIELDETNVLM
DLRERVGHLLVLGTTRVGKTRLAELLITQDIRRGDVVIVFDPKGDADLLKRMYAECQRAG
RGDEFHVFHLGWPDISARYNAVGRFGRVSEVASRVAGQLSDAGNSAAFKEFAWRFVNIIA
RALVALGQRPDFALIQRYVNNPGDLFEHYCESWLSQHHPDLWLTIENLTATLTERDVPRH
MEGRSLRVVAIEHVLGSDAGKRVYDPVLDGLRSSVRYDQKYYDKIVASLLPLLEKLTSGK
TAQLISPNYSDLNDPRPIFDWQQVIRKKGVVYVGLDALSDPEVAAAVGNSMFADLVSVAG
YIYKFGINDGLPQQSGGNTPISLHCDEFSELMGDEFIPLINKGGGAGIQITAYTQTLPDI
EAKIGNSAKAAQVVGNFNSLVMLRVRHTETAELLTRQLPEVEVYTKTLVSGVTDISNPDQ
GSDFTSNVQDRVSSVRTPLITPANVINLPKGQAFALLEGGRLWKLRMPLPAAGDDAFMPE
SISQIAGYMQKNYRTGDEWWSGGAMPGDRMIEEAEGEEE
NT seq 2100 nt   +upstreamnt  +downstreamnt
gtgagcgatcgctatgtgattgaagccctgctgcgaccggcggttgaactgaataccgcc
gtggtatccgcctgcgccagctatgtttgcgttaccgcgccgtgggcgattgctttagcg
cccagcgttagctacgtgatggccggagcgctggggatattcgcgattaagcgcacccgc
gaagggctgcgggtacttcgctatcgccgtaatatccggcgcttaccccgctacgtgatg
accagccgtcaggtgccagtgagccagatgaagctgttcctgggaaaaggctttttatgg
gagcagcggcacacgcagcgcctgctggatacgttacgcccggaggtcgccagatacgta
aacccttcctgggtttatcaggcggcgcggcgggttgaacaacgtcaggaatatcgtttt
ccgaccctgtgccggttactggcaagcgagagcgcgtttaatccggtaaggcctctgccg
cctgtgggcggtttaccggcgctgcacggcattgagctggatgaaaccaatgtgctgatg
gacctgcgcgagcgggtcgggcatttactggtgttgggcaccacccgggtagggaagacg
cgcctggctgagttactgattactcaggatattcgccggggagacgtggtgattgtgttc
gaccccaaaggggatgccgacctgctgaaaaggatgtacgcggagtgccagcgcgccggg
cgcggcgatgagtttcacgtctttcatctgggctggccggatatctctgcgcgctacaat
gctgtgggaaggttcggcagagtttcggaagtagcgagtcgggtcgccgggcagctcagc
gatgcggggaactccgccgcgtttaaagaatttgcctggcgctttgtcaatatcatcgca
cgggcgctggtcgcgctgggacaacgtccggacttcgcgctgatccagcgctacgttaac
aaccccggcgatctgtttgaacactattgcgaaagctggctgagccagcaccatcccgac
ctgtggttgacgatagaaaacctgacggcgacgctgacggagcgtgatgttccccgtcat
atggaagggcgctccctgcgtgtggtggcgattgaacatgtgctgggtagcgacgccgga
aagcgggtgtatgacccggttctggacgggctgcgttcctcggtgcgctatgaccagaag
tactacgacaaaattgtggcttcgctgctgccgctgctggaaaagctgacctccgggaag
acggcgcagctcatctctccgaactacagtgacctgaacgacccacgcccgatctttgac
tggcagcaggttatccgcaaaaagggcgtggtgtacgtcggcctggatgcgctctccgat
cctgaagtggctgcggcggtaggtaacagcatgtttgctgatttggtgtcggtggcgggc
tatatctataagttcggcattaatgacggcctgccgcagcagagcggcggcaacacaccg
atcagcctccactgtgacgaattcagtgaattaatgggggacgagttcattcctctgatt
aataaagggggcggcgcggggatccagatcacggcctacacccaaacgctgccggatatc
gaggcgaaaatcggtaactccgccaaagcggcgcaggtggtgggtaacttcaatagtctg
gttatgctgcgggtccgccatacggaaaccgctgagctactgacccgacaactgccggaa
gtggaggtgtataccaaaacgctggtttccggcgtgactgacatttccaatcccgatcag
ggcagcgacttcaccagtaacgttcaggacagggtcagcagcgtgcgaacgccgctgata
acgcccgccaacgttattaatttgccaaaagggcaggcgtttgcgctgcttgaaggcggg
cggctctggaaattaaggatgccgcttccagcagcaggcgatgatgcctttatgccggag
agcatcagccagatcgccggatatatgcagaaaaactaccgcaccggggatgagtggtgg
tcaggcggcgcgatgccgggcgaccgcatgattgaagaggcagaaggagaggaagaatga

DBGET integrated database retrieval system