KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_45140Help
Entry
KPHS_45140        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859
Motif
Other DBs
NCBI-GeneID: 11849567
NCBI-ProteinID: YP_005228814
UniProt: A0A0H3GXM7
Position
complement(4541518..4542030)
Genome map
AA seq 170 aa AA seqDB search
MKSIYLLGLCCLFGNAHAGLNVIADLGGEPAAPYFDGINNQPNEFESPNPPEAAVLPAAP
ASLASVLPISTPELTPGSVEARRLGLPGMQPIFLLGNDPLSRRWLDERKESLRQLRAVGL
VVNIEDEAAFGELQTLAGDIELLPVSGSDLAKRLGLQHYPVFISEKGIEQ
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcatttaccttttgggactctgttgcctgtttggcaatgcgcacgccgggctg
aacgttattgccgatttgggcggggaacctgccgcaccttattttgacggcattaataat
cagcccaatgaatttgaatcaccaaacccgccggaggcggctgtattgcccgctgcaccc
gcgtcactggcatcggtattgccaatatccacgcctgaattaacgcccggcagcgtagag
gcccgccgcctcggtttaccagggatgcagccgatatttttgttgggtaacgatccgctg
tcccgccgttggctggatgaacgaaaggaatcgctgcggcagctgcgggccgttgggcta
gtggtcaatatcgaggacgaagcggcgtttggcgagctgcaaacgctggccggtgatatc
gagctgctgccggtatccggcagcgatctggcgaagcggctggggttgcaacactacccg
gtattcatcagcgaaaagggaattgaacaatga

DBGET integrated database retrieval system