KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_p200810
Entry
KPHS_p200810      CDS       T01733                                 
Name
(RefSeq) conjugal pilus assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpm02044]
    KPHS_p200810
Secretion system [BR:kpm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KPHS_p200810
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-GeneID: 11844894
NCBI-ProteinID: YP_005229697
UniProt: A0A0H3H1D1
Position
pKPHS2:complement(62227..62979)
AA seq 250 aa
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLAT
LQAATKRSLYEAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSH
YNGTVKNQLAADYAEQRQAISTLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIP
VSVDGVINPMLPDSRTDQGQAEQLGVKFFPAMMLVNPKSGQVKPLSYGFISQDDLAKQFL
YVSSDFKPNF
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcgaacaatacatgccgccatgctggcggggtgcctttgctgcgccctgatgccggct
ttcgccaaagacgcgggctggcagtggtacaacgagaaactgaagccccgtgatgaggac
aggaaagccgtaccagcggcaccaccgccgcaaatggatattctggagaaactcgccaca
ctccaggcggccaccaaacggtcgttgtacgaagccattctgtatccatcgtctgaaaac
ttcgtgaagtatttccggctgcagaactactggacgcagcaggcaggtttgttctcgatg
agtgcgaagaaagccatgctggaaaaccccgaactcgattacaacctgcagtacagccac
tacaacggcacggtaaaaaaccagctcgctgccgactatgccgaacagcgacaggctatc
tccaccctcgcacagcactacggcgtgatgttcttctaccggggccgggaagcgatcgat
ggccagctggtccaggtgattaaaaattttcgcgaaacctatggcctgagcgtgataccg
gtgtcggttgacggagtgattaaccccatgctgcccgacagccggacggaccagggccag
gcagagcagcttggcgtgaagttcttccccgcgatgatgctggttaaccctaaaagtggc
caggtgaagcctctcagttacggctttatcagtcaggacgacctggcgaaacagttcctc
tatgtctccagcgactttaaaccgaatttctaa

DBGET integrated database retrieval system