KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00119Help
Entry
KPN_00119         CDS       T00566                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00010  Glycolysis / Gluconeogenesis
kpn00020  Citrate cycle (TCA cycle)
kpn00620  Pyruvate metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
Module
kpn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_00119 (aceF)
   00020 Citrate cycle (TCA cycle)
    KPN_00119 (aceF)
   00620 Pyruvate metabolism
    KPN_00119 (aceF)
Enzymes [BR:kpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KPN_00119 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: ABR75579
UniProt: A6T4Q8
Position
140355..142253
Genome map
AA seq 632 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLIMIFDSAEGAAAAAPAQEEKKEAAPAAAAPAAAAAAKEVHVPDIGGDEVE
VTEIMVKVGDTIAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMIFEV
AGAAPAAAPAQAAAPAAAAPAAAAGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAQAAAPAPAAA
PAQAAKPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRE
DVQAYVKEAVKRAESAPAAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSR
NWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFN
SSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKL
TAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPIS
LSFDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagttggcgacaaagtagaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagattaaagtctcc
gtcggcgacaaaaccgagactggcaaactgattatgattttcgattccgccgaaggtgca
gccgccgctgcacctgcgcaggaagagaagaaagaagccgctccggccgccgctgctcca
gcggctgccgcggcagcgaaagaagttcacgtcccggatatcggcggcgatgaagtcgaa
gtcaccgagatcatggttaaagtgggcgacaccatcgccgctgagcaatccctgatcacc
gtagaaggtgataaagcctctatggaagttccggcgccgttcgccggtaccgtcaaagag
atcaaaatcaataccggcgataaagtttccaccggctccctgattatgatcttcgaagtg
gcgggcgctgcgcctgcagccgctccggcacaggctgccgcgccggctgctgcggctccg
gctgccgcagcaggcgtgaaagatgttaacgtcccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggttaaagtcggcgataaagtcgcggcggaacagtccctgatcacc
gtagagggcgacaaagcctctatggaagttccggcgccgttcgcgggtaccgttaaagag
atcaaaatcagcaccggcgataaagtcaaaaccggttccctgatcatggtcttcgaagtg
gaaggcgctgcgcctgccgccgctccggctcaggctgctgcaccggcaccagctgctgcc
ccggctcaggccgctaagcctgccgctgcgccggctgcgaaagcagaaggtaaaagcgaa
ttcgctgaaaacgatgcctacgttcacgcgaccccgctgattcgccgcctggcgcgcgag
ttcggtgttaacctggcgaaagtgaaaggcaccggccgtaaaggtcgtatcctgcgcgaa
gacgttcaggcttacgtgaaagaagcggttaaacgcgctgaatccgcaccggctgctgcc
gcaggcggcggtatcccgggcatgctgccgtggccgaaggttgacttcagcaagtttggc
gaagtcgaagaagtggagctgggtcgtatccagaaaatctctggcgccaacctgagccgt
aactgggtgatgattccgcacgttacccacttcgacaaaaccgatatcaccgatctggaa
gcgttccgcaagcagcagaatgccgaagctgagaagcgtaaactggacgtgaaattcact
ccagtggtcttcatcatgaaagcggttgccgctgcgcttgagcagatgccgcgcttcaac
agctcgctctccgaagatggtcagcgcctgacgctgaagaaatacatcaacatcggtgtg
gcggtggataccccgaacggtctggtggttccggtcttcaaagacgtgaacaagaagagc
atcaccgagctgtctcgtgaattgaccaccatctcgaagaaagcgcgcgatggcaaactg
acggctggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtacc
acccacttcgcgccgattgttaacgcgccggaagtggccatcctcggcgtgtctaagtcc
gcgatggagccggtatggaatggtaaagagtttgtgccgcgcctgatgctgccaatctct
ctgtccttcgaccaccgcgtcatcgacggtgctgatggtgcccgcttcattaccatcatt
aacaacaccctgagcgacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system