KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_00151
Entry
KPN_00151         CDS       T00566                                 

Gene name
pulM
Definition
(GenBank) Pullulanase M protein
  KO
K02462  general secretion pathway protein M
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPN_00151 (pulM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_00151 (pulM)
Secretion system [BR:kpn02044]
 Type II secretion system
  General secretion pathway protein
   KPN_00151 (pulM)
SSDB
Motif
Pfam: T2SSM DUF4131
Other DBs
NCBI-ProteinID: ABR75611
UniProt: A6T4U0
Position
complement(176028..176513)
AA seq 161 aa
MANLLIWWRQRTPSEQRLLLGLTGLLAACAFWYGLWQPWRAREAQWRQTLVKEQASLRWM
TEQAPRLQQLSQQPAPAAKEALTALVMREAASHGLTVIRLQPQGKRLQITLQHCAFQALI
DWLDAPAMRGVNAISLSVTGQPSRPGWVTVNHLLLERDDEG
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctaatctgcttatctggtggcggcagcgcacgccgtcggagcagcgcctgttgctt
ggtctgacagggctgctggcggcatgcgccttctggtatgggctgtggcagccctggcga
gcccgcgaggcgcagtggcggcaaaccctggtgaaagagcaggccagcctgcgctggatg
acggagcaggctccgcgcctgcagcagctcagccagcagcccgcgccggcggcaaaagag
gcgctcaccgcgctggtgatgcgcgaggcggcgagccacggactgacggtcatccgcctg
cagccgcagggaaaacgtctgcagatcacccttcagcactgcgctttccaggcgctgatc
gactggctggacgctccggcgatgcgcggcgtcaacgcgatctcgctgtccgtgaccggg
cagccgtcgcgacccggctgggtcacggtcaaccatctgctgctggagcgcgacgatgaa
ggctaa

DBGET integrated database retrieval system