KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_00636Help
Entry
KPN_00636         CDS       T00566                                 

Definition
(GenBank) putative D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00260  Glycine, serine and threonine metabolism
kpn00680  Methane metabolism
kpn01100  Metabolic pathways
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
kpn01230  Biosynthesis of amino acids
Module
kpn_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    KPN_00636
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN_00636
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpn04147]
    KPN_00636
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     KPN_00636
    1.1.1.399  2-oxoglutarate reductase
     KPN_00636
Exosome [BR:kpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN_00636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD IlvN XdhC_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABR76086
UniProt: A6T665
Position
722499..723527
Genome map
AA seq 342 aa AA seqDB search
MKIVFTAEHAGDLSAFHQLGELLVEGWALGKPKLSAGQLIELAHDAEVLVTSYDEVTDAV
MAACPRLQVIACTRANPVNIDTQAAQARGIRVLYTPGRNADAAAELTLGLMLSLARHIPQ
SHAALKRGEFTQADNASAATQQGLRRDVVWDVSPESPYEVFKGSELRNKTLGLVGYGNIG
RRVARIARAFGMAVLVVDPFVAAEDINEPGLQKTTLEALFREADIVSLHLSSGPHSDGLV
NAALLNSMKPGALLINTSRAAVVDEAALIDALRHGPLGGAALDVYHREPLWRDHPFVIEF
DNVIITPHIAGATRESIAKHTAMIAADLQRYVAGEPLLYQWR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtttttaccgccgagcatgctggcgaccttagcgccttccaccagctgggc
gagctgctggtggaggggtgggcgctgggcaaaccgaaactcagcgccggtcagctgatt
gagctggcccacgacgccgaggtgctggtgaccagctatgatgaggtgacggacgcggtg
atggccgcctgtccgcgcctgcaggtaatcgcctgcacccgcgcgaatccggtgaatatt
gatacccaggccgcccaggcgcgcggcatccgggtgctctacaccccggggcgcaatgcc
gatgccgccgcggagctgacgcttggcctgatgctcagcctggcgcgccatattccgcaa
tcccatgcggcgctgaagcggggggaattcacgcaggctgacaatgcctccgccgccact
cagcagggtctgcggcgggatgtggtctgggacgtgagcccggaaagcccctatgaagtg
tttaaaggcagtgaactgcgcaataaaacgctggggctggtggggtatggcaacattggc
cgccgggtggcgcgtatcgcccgggcgttcggcatggcggtgttggtggtggatccgttc
gtcgccgcagaggatatcaatgagccagggttacagaaaacgaccctggaggcgctgttc
cgcgaggcggatatcgtcagcctgcacctgagcagcgggccgcacagcgacgggctggtg
aatgccgcgctgttaaacagcatgaagcccggcgcgctgctgatcaatacctctcgcgcg
gcggtggtcgacgaggcagcgctgattgatgccctgcgccacggcccgctgggcggcgcg
gcgctggatgtctatcaccgcgaaccgctgtggcgcgatcatccttttgtcatcgagttc
gataacgtgattatcacgccgcatatcgccggagccacccgggagagtatcgccaaacac
acggcgatgattgccgccgatcttcagcgctatgtcgccggggagccgctgctgtaccag
tggcgttaa

DBGET integrated database retrieval system