KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_00765Help
Entry
KPN_00765         CDS       T00566                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00620  Pyruvate metabolism
kpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPN_00765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpn02000]
    KPN_00765
Enzymes [BR:kpn01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     KPN_00765
Transporters [BR:kpn02000]
 Other transporters
  Primary active transporters [TC:3]
   KPN_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ABR76201
UniProt: A6T6I0
Position
850358..852124
Genome map
AA seq 588 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQAALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTQYDTGLDIHRLESIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLGGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLNGADPVTCRPADLLKPELAQLEADVKRQAQEK
GITLAENAIDDVLTVALFPQIGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGVYT
VEVEGKAFVVKVSDGGDVSQLTAAAPAPGSAPAAPAGAGTPVTAPLAGTIWKVLASEGQT
VAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMTLA
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgccacc
cgtctgcgtctcgacgatatgctgcccgttgccgctcagctggacgacgtcggctaccgc
tcgctggagtgctggggcggcgccacctttgacgcctgcatccgcttcctcggcgaggac
ccgtgggtccgcctgcgcgagctgaaaaaggcgatgcccaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgacgacgtggtggagcgcttc
gtcgagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgac
ccgcgcaacatgcaggccgccctgcaggcggtccgccgccacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcgcacaccctgcagacctggctcgacctcaccgaa
cagttgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaagaagcgctacgacgtcaccctgcac
ctgcactgccacgccaccaccgggatggcggagatggccctgctgaaggccattgaagcc
ggggtcgacggcgtcgacaccgccatctcctcgatgagcgccacctatggccacccggcc
accgaggcgctggtcgccaccctcgccggcacgcaatatgacaccgggctggatatccac
aggctggagagcatcgccgcgtactttcgcgaggtgcgcaaaaaataccacgccttcgaa
ggccagctgaagggcaccgacagccgtatcctggtggcccaggtgccgggcgggatgctc
accaacctcgaaggccagctgaagcagcagagcgccgcccaccgtctggatgaagtgctg
gcggaaatcccccgcgtgcgcgaggacctcggcttcatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtgctgggcggcgagcgctacaaaaccatt
gcgaaggagactgccggtatcctgaagggcgagtacggccgcaccccggccccggtgaac
gccgccctgcaggcgcgggtgctcaacggcgccgacccggtgacctgccgcccggccgac
ctgctgaagccggagctggcgcagctggaagcggatgtgaaacgccaggcacaggagaag
ggcatcacgcttgccgaaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctgaagttcctcgaaaaccgccacaacccggcggcctttgagccggtaccgcag
gcggaagccgcgcagccagtggcaaaagcagaaaaacctgccgcctccggcgtctacacc
gtggaggtggaaggcaaagccttcgtggtcaaagtcagcgacggcggcgacgtcagccag
ctgacggcggctgctcctgctcctggctctgcacccgccgctccggccggcgccggcacc
ccggtgaccgccccgctggcgggcactatctggaaggtgctggccagcgaaggccagacg
gtggccgcaggcgaggtgctgctgattctggaagccatgaagatggaaaccgaaatccgt
gccgcgcaggccgggaccgtgcgcggtatcgcggtgaaagccggcgacgcggtggcggtc
ggcgataccctgatgactctggcgtaa

DBGET integrated database retrieval system