KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01054Help
Entry
KPN_01054         CDS       T00566                                 

Definition
(GenBank) putative arginase/agmatinase/formimionoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00220  Arginine biosynthesis
kpn00330  Arginine and proline metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01130  Biosynthesis of antibiotics
kpn01230  Biosynthesis of amino acids
Module
kpn_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KPN_01054
   00330 Arginine and proline metabolism
    KPN_01054
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KPN_01054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABR76488
UniProt: A6T7B7
Position
complement(1204306..1205190)
Genome map
AA seq 294 aa AA seqDB search
MTTQKVPMTSKTLRLIFPQWQGGNNPPYYLGSQLLSFLSPEAKGPVEIVPVELPTTEPLP
RINDITAKPSLIRQLNNAAALIEKHDPNSIVILGGDCLVSLAPFAHLLDKFGDKLGVLWI
DSHPDVQTAEQYPNAHAHVLGALMGTGDNDLVAHVKTKLNPSKIMIAGIHAPLPYEAEYL
TRHNITTLAPEQVKSGADEVLEWIAKEKIAYLAIHIDLDVLDPSLFRSILFAKPGRGKHD
FGDVAEGKLTIEDVLNLIAAATTKAVPVGLTIAEHLPWDMLNLKNMLSELPLLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacagaaggtaccaatgactagcaaaacactgcgacttatattccctcaatgg
caaggcggtaacaatcctccctactatcttggctcgcagctcctctcgtttctctctcct
gaagcaaaagggcccgttgagatcgttcctgttgagttaccaacaacagagccattgcca
aggattaatgacatcacggctaagccatccctcatcaggcaactcaataatgctgccgca
ctgattgaaaaacatgatcccaatagcattgtcattttaggcggagactgcctggtttcg
ctggcgcctttcgcccacctgctcgataagttcggagacaaactcggtgtgctctggatt
gactcgcatcctgacgtgcagacggctgaacaatatccaaacgcgcatgcccatgtgctt
ggtgcgctaatgggtacgggtgataacgatttagttgcccatgtaaaaaccaaacttaat
ccgtcaaaaataatgattgccggtatccacgcgccacttccttatgaagctgaatacctc
actcgccataacattacgacgctagcacctgaacaggttaaaagcggtgcagatgaagtc
ctggagtggatagcgaaagaaaagattgcgtatctggcgatccatatcgatctggacgta
ctcgacccatctctgttccgctccattctttttgcaaaaccggggcgcggaaaacacgat
tttggcgacgttgctgaaggcaaactgacgattgaggatgtactcaatctgatagcggca
gcgacgacaaaagcagtccccgttggcctgacaatcgctgaacatttgccctgggacatg
ctgaatctcaagaacatgctcagtgaattaccccttctaaagtaa

DBGET integrated database retrieval system