KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01121Help
Entry
KPN_01121         CDS       T00566                                 

Definition
(GenBank) putative pyridoxal phosphate biosynthetic protein PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPN_01121
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     KPN_01121
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     KPN_01121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Rapsyn_N
Motif
Other DBs
NCBI-ProteinID: ABR76554
UniProt: A6T7I3
Position
1272649..1273659
Genome map
AA seq 336 aa AA seqDB search
MMSAEKKPVVAITIGDPAGIGPEITVATMMDKSVYDECKPFLIGSVPIISRAMKIMGCDF
AIHKIAHPQEARFSWGTLDVLETGDYDCDSIEWGKVQKLAGQMSLDYVMKSIELGKAGLI
DVVSTAPIHKEAIKLAGCKLPGHTEIYQVETQSDYGLTMFHVHNLRVFFVSRHMALKAAC
DYANKARVLACVQQIHHEFTALNIKNPRIAVAALNPHGSDNGLFGHEEADNLIPAVKAAQ
EMGINAIGPVPADSVFHLGKQGRYDAILSLYHDQGHIACKTLDFERSITITFGLPFMRSS
VDHGTAFDIAGTGKAGTVSMLESTLVAARYWKMKHQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagcagagaaaaaacccgttgtggcgattaccattggcgatccggcagggatc
ggcccggagatcaccgtggccaccatgatggacaaaagcgtgtatgacgagtgcaaaccg
ttcctgatcggctcggtaccgattatcagccgggcgatgaaaatcatgggctgcgatttt
gctatccataaaattgcccatccgcaggaggcccgttttagctgggggacgttggatgtt
ctggaaactggcgactacgattgcgacagtatcgaatggggcaaggtgcagaaactggcg
gggcaaatgtcgctggactatgtgatgaagtcgatcgagctgggcaaagcggggctgatc
gacgtggtctctactgcaccaattcataaggaagccatcaagctggcaggatgtaagctc
ccgggccataccgaaatctatcaggtggaaacccaatctgattacggtctgaccatgttc
cacgtccacaacctgcgcgtcttcttcgtgagccgtcatatggcgctaaaagcagcctgt
gactatgccaacaaagcgcgagtgctggcctgcgttcagcagatccaccatgaatttacc
gccctgaacatcaaaaatccgcgcattgccgtggccgccctgaacccgcatggctccgac
aatggtctgtttggtcacgaagaggctgacaatctgatcccggcggtgaaagcggcccag
gagatggggatcaacgctatcgggccggttccggccgattccgtgttccatctcggcaaa
caggggcgctacgacgccattctctcgctgtatcacgatcaggggcatattgcctgcaaa
accctcgactttgaacgttcgatcaccattaccttcggcctgccgtttatgcgcagctcc
gtcgaccatgggacggcgtttgatatcgccggtaccggtaaggcgggtaccgtcagtatg
ctggagtcgacgctggtggcggcccgttactggaaaatgaagcatcaataa

DBGET integrated database retrieval system