KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01255Help
Entry
KPN_01255         CDS       T00566                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01130  Biosynthesis of antibiotics
kpn01230  Biosynthesis of amino acids
Module
kpn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPN_01255 (trpC)
Enzymes [BR:kpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KPN_01255 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     KPN_01255 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ABR76688
UniProt: A6T7W7
Position
complement(1408179..1409537)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIVPTQRNFYDALAGTRTAFILECKKASPS
KGLIREDFDPAAIASIYKHYASAISVLCDEKYFQGSFDFLPIVSQVAPQPILCKDFTIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLNMGVLTEVSNEEELERAIVLKAKV
VGINNRDLRDMSIDLNRTRQLAARLGPDVTVISESGIHTYAEVRELSHFANGFLIGSALM
EQADLEAAVKRVLLGENKVCGLTRPQDAQVAWESGAIYGGLIFVPTSPRAVNDAQAKAVI
AAAPLQYVGVFRNAPLEEVVARAQALGLAAVQLHGDEDQAYIDALRDALADNVRIWKALS
VGETFPARTLHHVDKYLLDNGQGGSGQRFDWSLLQGQDLRNVMLAGGLGADNCVEAAKSG
CAGLDFNSGVESQPGIKDASKLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcaaaaatcgttgccgacaaagcgatttgggtggaagcccgcaaa
caacaacaaccgttagccagttttcagaatgagatcgtcccgacgcagcgcaatttctat
gacgcgctggccggcacccgcaccgcgtttattctcgagtgcaagaaggcctcgccgtcg
aaggggttgattcgcgaggatttcgatccggcagcgatcgccagcatctacaagcactac
gcctcggcgatctcggtgctgtgtgatgagaaatatttccagggcagcttcgatttcctg
ccgatcgtcagccaggtcgcgccgcagccgatcctgtgtaaggacttcaccatcgaccct
taccagatctacctggcgcgctactatcaggccgacgcctgtctgctgatgctctcggtg
ctcgacgatgaacagtatcgtcagctctcggcggtggctcacagcctgaatatgggcgtg
ctgaccgaagtcagcaatgaagaggaactggagcgcgccatcgtcctgaaggcgaaggtg
gtgggcattaacaaccgcgacctgcgcgatatgtcgattgaccttaaccgcacccgtcag
ctggcggcgcgtctcggcccggatgtcacggtgatcagcgaatccggcatccatacctat
gccgaagtgcgcgagctgagccacttcgccaacggcttcctgatcggctccgccctgatg
gagcaggcggatctggaagcggcggttaaacgcgtgctgctcggcgagaacaaagtgtgc
ggcctgacgcgcccgcaggatgcccaggtggcctgggagtccggcgccatttacggtggg
ctgatcttcgtcccgacctcgccgcgagcggtgaatgacgcccaggccaaagcggtgatc
gccgctgcgccgctgcagtacgtcggcgtcttccgcaatgcgccgctggaggaggtggtc
gcccgcgcgcaggctctggggctggccgccgtgcagctgcacggtgatgaagaccaggcc
tatatcgacgcgctgcgcgacgccctcgcggacaacgtccgcatctggaaagcgctgagc
gtcggcgaaaccttcccggcccgtacgctccaccatgtcgacaagtacctgctcgacaac
ggccagggcggcagcggccagcgctttgactggagcctgctgcagggccaggatctgcgc
aacgtcatgctggcgggcggcctcggcgccgataactgtgtggaagcggccaaaagcggc
tgtgccggactcgatttcaattcaggcgtagagtcgcaacccgggattaaagacgccagc
aagctggcctccgtattccagacgctgcgcgcatattaa

DBGET integrated database retrieval system