KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01273Help
Entry
KPN_01273         CDS       T00566                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II protein
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00740  Riboflavin metabolism
kpn00790  Folate biosynthesis
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn02024  Quorum sensing
Module
kpn_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    KPN_01273 (ribA)
   00790 Folate biosynthesis
    KPN_01273 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KPN_01273 (ribA)
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     KPN_01273 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ABR76706
UniProt: A6T7Y5
Position
complement(1431480..1432082)
Genome map
AA seq 200 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEELATGQDHVALVYGDISGQSPVLARVHSECLTGDAL
FSLRCDCGFQLEAALSHIAEEGRGILLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLNVEQVRLLTNNPKKVEILTEAGINIVERVPLIVGRNPKNA
HYLDTKAAKMGHLLNSKPTE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaaacgtgtggcagaagccaaactgccaaccccctggggcgatttcctgatg
gtgggttttgaagaactggcaaccggacaggatcatgtcgcgctggtgtatggcgatata
tcagggcagtcgccggtcctcgcccgcgtacattcagagtgtttgacgggcgatgccctg
tttagcctgcgctgtgattgcggctttcaactggaagcggccctgtcgcatatcgctgaa
gaaggtcgggggatcctgctctatcaccgccaggaaggacgcaacattggtttattgaat
aagatccgcgcctacgcgctgcaggatcagggctacgacactgtcgaagcgaaccatcag
cttggcttcgccgccgatgagcgcgatttcaccttgtgcgccgacatgttcaaattgctc
aacgttgagcaggtgcggttattaaccaataacccgaaaaaagtggaaattcttaccgaa
gccgggatcaacattgtggagcgggtgccgctgatcgtcgggcgtaacccgaaaaacgct
cactatctggacaccaaagccgccaagatgggccatctgctgaacagcaagccgacggaa
taa

DBGET integrated database retrieval system