KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01323
Entry
KPN_01323         CDS       T00566                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_01323
Secretion system [BR:kpn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN_01323
SSDB
Motif
Pfam: VipB VipB_2 PaaA_PaaC
Other DBs
NCBI-ProteinID: ABR76755
UniProt: A6T834
Position
1484106..1485656
AA seq 516 aa
MLMSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASCLGDINDFLDDAALSEAPA
AERLTAAMQVFMERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESL
WRGLKQLVDNTDYRQNVKTEILDVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEP
IGSVISAYEFDASPQDVALLRNISRVSAAAHMPFIGAVGPAFFLKETMEEVAAIKDIGNY
FDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEQVKGPDHEKYLW
TSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEVMIPET
REFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIE
DNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgctaatgtctgttaccacagaaaacgcccctgttcaggggcaaaccacgctgcaggaa
aacagcgcgggcgagggcgtttacgcctcgctgtttgaaaaaattaatctcaccccggcg
tcttgcctcggggatatcaacgactttctggacgatgccgcgctctccgaggcgccggcg
gcggagcgtctcaccgcggcgatgcaggtgtttatggaacgcatccgtcagtccggccag
cgggtggaaaagctcgacaaaacgctgatcgaccaccatatcgccgagctggatttccag
ataagccgtcagctggacgcggtgatgcaccatcaggagtttcagcaggtcgaatccctg
tggcgcggcctcaaacagctggtggacaacaccgactatcggcagaacgtcaaaacggag
atcctcgacgtcgccaaagacgatctgcgccaggactttgaggacgcgccggagcttatc
cagagcggcctgtactggcacacctataccgcggagtatgacactcccggcggcgagccg
atcggctcggtgatctcggcctatgagttcgacgccagcccgcaggatgtggcgctgctg
cgcaatatctcccgcgtctctgcggccgcccatatgccgtttatcggcgccgtcggcccg
gccttcttcctgaaagagaccatggaagaggtggctgccattaaggatatcggcaactac
ttcgatcgtgcggaatatatccgctggaaggcgtttcgcgaaactgacgatgcccgctac
atcggcctggtgatgccgcgcgtgctgggtcgtctgccgtacggtccggacaccgtgccg
gtgcgcagcttcaactatgtcgagcaggtgaagggcccggatcacgaaaaatatctctgg
accagcgcggcgttctccttcgcatctaatatggtgaagagctttgttaacaacggctgg
tgcgtgcaaattcgcggtccgcaggcgggcggcgcggtgaaagatttgcctatccatctg
tacgatctgggcaccggcaaccaggtgaagatcccttccgaggtgatgatcccggaaacg
cgggagtttgagttcgccagcctgggctttatcccgctgtcgtactacaaaaatcgcgat
tacgcctgcttcttctcggccaactccgcgcagaaaccggcgctgtacgataccgccgac
gccaccgccaacagccgtatcaacgcgcgtctgccttacatcttcctgctgtcgcgcatc
gcgcactacctgaagatgatccagcgcgaaaatatcggcaccaccaaggaccggcgtctg
ctggagctggagctgaacacctgggtgcggagcctggtgaccgaaatgaccgaccccggc
gacgagctgcaggcctcccatccgctgcgcgatgccagcgtggtggtggaagatatcgag
gataacccgggcttcttccgcgtgaagctgtacgcggtgccgcacttccaggtcgagggg
atggacgtcaatctgtcgctggttagccagatgccaaaggcgaaggcgtag

DBGET integrated database retrieval system