KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01327
Entry
KPN_01327         CDS       T00566                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPN_01327
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_01327
Secretion system [BR:kpn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN_01327
SSDB
Motif
Pfam: T6SS_HCP Inhibitor_I24
Other DBs
NCBI-ProteinID: ABR76759
UniProt: A6T838
Position
1489403..1489894
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHD
IKNPAYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggcgcggacattaaagggtct
gtcgacgttcaggatcgtgaaggcagtatcgaagtggtggctcaggagcataacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacgcgtattcatacgccgttcctg
ttcaccaaggagatcgactcctccagcccctacctgtacaaggcggtgaccaccggtcag
accctgaagtccgccgagtttaagtggtaccgaatcaacgatgccggccaggaagtggag
tatttcaataccaaacttgagaacgtcaaggtggtaaaagtgaatcccctgatgcacgac
atcaaaaaccccgcctacgagaagcacaaccatctggaacagattgagctgcgctacgag
aagatcacctggacctataaagacggcaacatcattcactccgatagctggaacgaacgc
gccaccgcgtaa

DBGET integrated database retrieval system