KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01342
Entry
KPN_01342         CDS       T00566                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPN_01342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_01342
Secretion system [BR:kpn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN_01342
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: ABR76774
UniProt: A6T853
Position
1505225..1508599
AA seq 1124 aa
MTFIVWKHPDMAGLEGDSQQQNYWLIGGCCITGCIFIMLVMLLWTARSAGKKEFEALLDV
TRGDDNKRKDESENISVSPAVVMCARIRDHLRTRIGIHWRRKVRLLLVTGDEAAIEQLVP
GLRQQHWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIVRVMPSSLTLTPQIS
ESDLRGLEKISELLGYAAPVWLWKLCDSEWPQADRAVQAVGVSFPLRATEEDVARQLAQM
LPTLREQGMHQIAADTRHDFLLRLGQQLIDGEIAQWRRQLAPWLTASRQRLALRGLMFSL
PEPRTVDPYQETDTSPAGQPHLLTLPVTWQGIVDDCRRLRGHHVGMAWERGLACGLLAIL
GLWAAGLLLSFALNYSHIASVAGKARDLMAHPSVSDYQLTALHALRNEAGRLVHDGQKGA
PWYRRFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALSALVNSAPNSDQRARLAK
PGYDQLKAWLMMARPDKADGAFFALTMKTVQPTRMGISTGLWQSLAPDLWAFYLSLLPER
PEWKIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARR
LFTTDEVVPGMFTRQAWEGGIQQAIDKAASSRREEIDWVLSDSRKTVSTDLSPEALKARL
TRRYFTDFAGSWLNFLNSLRLNPATNIADVTDQLTLISDVRQSPLIALMNTLAWQGQAGQ
QREGLSDSLIKSAKDLVGGKDKPVIDQSAAGPQGPLDDTFGPLLQLMGKNTGSNVMSADS
TLSLQTYLTLITRVRLRLQQVANATDPQEMMQTLAQTVFQGKSVDLTDTQQYGSLISASL
GEEWSGFGNTLFVQPLTQAWETVLLPSAASLNDKWRRSVVANWHTAFDGRFPFAASKSDA
SLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVPDKVNSHGLVFNPAFLRAINQLSQ
LSDILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGT
LLTWTTVNAGTRLFGDYSGTWGFIRWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLRSQL
GSGPLALLALRGLTLPDQIFTVDAAESAQALTTGVGNSDMDEME
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgacatttatcgtctggaaacatcctgacatggccggacttgagggcgatagtcagcag
cagaattactggcttattggtgggtgctgcattaccggatgtatctttatcatgttagtt
atgctcctgtggacagctcgcagtgccggtaaaaaggagtttgaggcgctcctggatgtc
actcgtggtgatgacaataagagaaaagatgagagtgaaaacatctctgtttctccagca
gtggtgatgtgtgccaggattcgtgaccatctgcgaacccgaattggaattcactggcgg
cgcaaagtccgcctgcttttagtcaccggcgacgaggcggcaatcgaacaactggtgcct
ggcctgcgtcagcagcactggcttgaaggcaaccgcaccgtgctgatttacggcggcagc
cttgcatcggagcctgaccgagaaaaatacatcgcgctgcgcaagctgcgccgcggtcgt
cctctggatgggattgtgcgggtgatgccgtcgtctctcaccctgacgccgcagataagc
gagagcgacctgcgcgggctggaaaaaatcagcgaactgctgggctatgccgccccggtc
tggttatggaaactgtgcgacagtgagtggccgcaggctgaccgcgcggtgcaggcggta
ggggttagcttcccgttgcgcgccactgaggaagatgtcgcccgtcagcttgcgcagatg
ttgcccacgctacgggagcaggggatgcaccagatcgcagcggatacccgccacgacttc
ctgctgcgtctggggcagcagcttatcgacggggagatcgcacaatggcgccggcagctg
gcgccgtggctgaccgcctcgcggcagcggcttgcgctgcgaggcctgatgtttagcctg
ccagagcctcgtaccgtagatccgtatcaggagacggatacctcgcctgcgggccagcct
catctcctgacgctgcccgtcacctggcaggggatcgtcgatgactgccgccgtttacgc
gggcatcacgtgggaatggcgtgggagcggggcctggcgtgcggtctgctggccatcctc
ggcctgtgggcggcgggactgctgctctcctttgccctcaattacagtcatattgcttcg
gtagcgggaaaagcccgcgacctgatggcccacccctccgtttctgactatcaactgacg
gccctccatgccctgcgcaatgaggccggccgtctcgtgcacgatgggcagaagggagca
ccctggtatcggcgctttggtctggaccatcatcagcaactattaaacgccgtcctacct
tggtacggtgtggcgaatcatcgcctgatacgtgacccggccaatgccgcgttgcagcag
gcgctcagcgcgctggtcaactccgcccccaatagcgaccaacgagccaggctggcgaaa
ccgggctatgaccagctgaaagcctggctgatgatggctcgtccggataaagccgatggc
gcatttttcgcgctgaccatgaaaacggtccagccgacgcgaatggggatctcgaccggt
ctgtggcaaagtctggcgccggatttgtgggccttttatctctccctgctgcccgagcgg
ccagagtggaagatcatcccggatgcgcaacgggtgagtcagagccgtcaggttctgttg
cagcagctaggtcgccgcaatgccgaaagcaccttatatgagaacatgctcaaatccgtg
cgtcgtaattttgccgatgtgtcgctggaagacatgaccagtggcaccgacgcgcgccgc
ctgtttaccaccgatgaagtggtcccggggatgtttacccgccaggcatgggaaggcggc
attcagcaggccattgataaggcagccagctcgcgccgggaggaaatcgactgggtgctg
agcgattcgcgcaaaacggtgtcgacagacctgtcgccggaggcgctgaaagcgcgtctg
acccgacgctacttcaccgatttcgccggcagctggctgaattttctcaacagtctgcga
cttaatccggcgaccaatatcgccgatgttaccgaccagctcacgctgattagcgatgtc
cgccagtcgccgctgattgccctgatgaataccctcgcctggcaggggcaggcggggcaa
caaagggaggggctgtcggacagccttattaaatcggccaaagatctggtgggcgggaaa
gacaagccggtcatcgaccagtcggcagccggcccgcaggggcctctggatgacacgttc
ggcccactgctccagctgatggggaaaaacacgggcagcaacgtcatgtcggccgatagc
accctgagcctgcaaacctatctgacccttatcacccgcgtgcgcctgcgcctgcagcag
gttgcgaatgccaccgatccgcaggagatgatgcagaccctggcgcagaccgtcttccag
gggaaaagcgtcgacctgaccgacacgcaacagtacggcagcctgatttcggcaagcctt
ggcgaagagtggagtggcttcggtaatactctgtttgtgcagccgctgactcaggcctgg
gaaaccgtgcttctgccgtcggcggccagtctgaatgacaaatggcgccgatcggtggtc
gccaactggcacaccgcctttgacggacgctttccgtttgccgccagcaaaagcgacgcc
tcgctgccgatgctggctgagtttgtgcgcaaggacagcgggcggatcgaacgttttctc
acgacggagctgaacggtgtcctgcataaagaaggcagtcagtgggtgccggataaggtc
aacagtcacggcctggtctttaatccggcctttctgcgcgccatcaaccagctaagccag
ctgtccgacattcttttcaccgacggaagccaggggatcagctttgagttacaggccagg
cctgccccggaggttgtcgagacacagctgacgatagacggccaaaagttgcgctatttc
aatcagatggccgactggcagactttccgctggccgggggagacgtataaacccggtact
ctgcttacctggaccaccgtcaatgcgggcacgcgcctgttcggtgactacagcggcacc
tggggttttattcgctggctggagcagggtaaacgccatccgctggatcgcagccagtgg
atgatgagcttctccgccccggatggccgcaccctgcagtgggtattgcgctcccagctt
gggagcggcccgttggcgcttctggcgctgcgcggattgaccctgccggatcagattttc
actgtcgatgcggctgagagcgcacaggccctgacgacgggggtagggaatagtgacatg
gatgagatggaataa

DBGET integrated database retrieval system