KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01347Help
Entry
KPN_01347         CDS       T00566                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_01347
Secretion system [BR:kpn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN_01347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ABR76779
UniProt: A6T858
Position
1512893..1514647
Genome map
AA seq 584 aa AA seqDB search
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRM
REKLDDDLPELTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKESMTIGKGFEVLSRPIG
EKGTRCRYTTTKAIALQPLSLERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYC
NADAPLACAMHEAFTLNVARMWLRMPDEVDRRPLDGYFSALGFGEDDGLWPEDGRSFRGY
QLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLAERWEHDFRFSEKQLRLHCVP
VINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYAPFSSFRHKGG
MMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLR
GTLALYEWTDSEMNRRRLEAILDVKHRATERFAQGHLVRGVQIEVTLDSHGFAGRGDICL
FGEMLSRFFALYTDIYLFNRLIIILQPTGERLEWEEKHSRRIPG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggacgatttaaccctgcgttattacgacgctgaaatgcgctacctgctggaagcgggt
gaagagtttgcccgcgctcatcctgagcaggcggcaatgctcaatctcgacaaagcgggc
gcccgcgacccctttgtcgagcgcctgtttgaaggttttgccttcctgatgggccgcatg
cgcgagaaactcgatgacgatctgcctgagctgaccgaaggcgtggtcagtctgctgtgg
ccacattatttacgtaccattccctcgatgtcggtcgtggagttcacccccgactggccg
gaaatgaaagaatcgatgacgataggcaaaggttttgaagtgctttcccggccgatcggt
gaaaagggcacgcgctgccggtacaccaccaccaaagcgatcgctctgcagccgttatcc
ctggaacgcgtccagctggccaccgatacggatggccggtcggtgatcacgctgcgcttt
acctgcagccagctgacggactggcgccgggtcgatctcagtcatatcccgctgtactgc
aacgccgatgcgccgctggcctgcgccatgcacgaggcctttaccctcaatgtggcccgg
atgtggctgcgcatgcccgatgaggtggacagaaggccgctggacgggtatttcagcgcg
ctgggatttggcgaggatgacggcctctggcctgaagatggccgcagttttcgcggttac
cagctgctgctggagtattttaccttccgcgaaaagttcatgttcatcgatctgcgcggg
ctggagacggtggcttttccggccggactggcgtggtttgaaatcgacgtcgtgctggcg
gaacgctgggaacatgacttccgcttcagcgaaaagcagctgcgcctgcactgcgtgcca
gtgatcaacctgtttccgctggagtccgatccgctgaccatcaattccctgcagaccgaa
tacccgctgcgcccgatgcgcgtgcaggacggccacaccgaaatttacaccgtcgattcc
gtgatctcctcacaccagcaggtttacgcgccgttctcaagttttcgccacaaaggcggc
atgatgcgtcatgacgcggcggactattactatcatacccgggtgcgccgtggcccctcc
gggctgtacaacacctggcttatcgtcggcggagaagcctttgataatcataccgtaccg
gaagatgaaagcctgtcgctgaccctcaccggaaccaacggccagctgccgcgtcgcgcg
ctgcagagcaccgtgctcgatacggtgatgaaaaccacttccgccagtattgcagtgcgt
aacctctgcgcgccgacgctgccgtgctatccccccgcccaggaccgttttcactggcgg
gtgctgagccatctgggcagcagttttctttccctgatggataacgcggaggtcctgcgc
ggcaccctggcgctgtatgaatggaccgacagcgagatgaatcgtcggcgtctggaagcc
atcctcgacgtgaagcaccgcgcaacagagcgctttgcacagggccatctggtgcgcggc
gtacagattgaagtcaccctcgacagtcacggctttgccggacgaggcgatatatgcctg
tttggcgagatgcttagccgcttcttcgcgctctacaccgacatctacttgttcaaccgc
ctgattatcattctgcaaccaaccggagaacgactggaatgggaagagaagcacagccgc
cgcattcccggctga

DBGET integrated database retrieval system