KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01691Help
Entry
KPN_01691         CDS       T00566                                 

Definition
(GenBank) putative gluconolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00053  Ascorbate and aldarate metabolism
kpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    KPN_01691
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     KPN_01691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: ABR77122
UniProt: A6T951
Position
complement(1870428..1871306)
Genome map
AA seq 292 aa AA seqDB search
MRIEVLLDLKTRLGESPVWDVEQQRLWWVDSLDGRLFACNAQGGAIKSWDVRQKIGSFAL
RQNGEGAVVALQNGVHLLDFASGELTLLHHPEADRPFNRLNDGKVDRQGRFLFGSMDMRE
EEPSGALYRLDADLSLHVLKKDIIVSNAPCWSPSGETFYFADTWTGEICAWDYNTATGDL
SGERVFCHVDRREGGAADGATVDSEGYLWNALVYAGKLVRYTPEGKVDRIIEMPVKKVTS
VMFGGENLDVLYVTSMAQPPLPRFPEDNQLRGSLFAIYDLGVTGVAERRFAG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgaagtgttactggatttaaaaacccgactcggcgaaagcccggtctgggat
gtcgaacagcagcgtctttggtgggtggacagcctcgacgggcgcctgttcgcctgcaac
gcgcagggcggcgcgatcaagagctgggacgtgcgacagaaaattggctctttcgccctg
cgccagaacggtgaaggcgcggtggtggcgctgcagaatggcgttcatctgctcgacttc
gccagcggcgagctgacgctgttgcaccatccggaagcggaccgaccctttaaccggctc
aacgacggcaaagtcgatcgtcagggacgctttctgttcgggtcaatggatatgcgcgaa
gaggaaccgagcggcgcgctatatcgcctggacgccgatctgtcactgcacgtgctgaag
aaagacattatcgtctctaacgccccctgctggagcccctccggcgagaccttctatttt
gccgatacctggacgggcgaaatctgcgcctgggactacaacaccgcgaccggcgatctt
tccggcgaacgggtcttttgccatgtcgatcgccgcgaaggcggcgcggcggacggcgcc
accgtggacagcgaaggctatctgtggaacgcgctggtctacgcgggcaagctggtgcgc
tataccccggagggcaaggtcgatcgcatcattgagatgccggtgaaaaaagtgaccagc
gtgatgttcggcggcgaaaaccttgatgtgctgtacgtcacctccatggcgcagccgccc
ctgccgcgcttcccggaagataatcagctgcgcggcagcctgttcgccatttacgacctg
ggcgtgaccggcgtagcggaacggcgcttcgccggctaa

DBGET integrated database retrieval system