KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01693Help
Entry
KPN_01693         CDS       T00566                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00071  Fatty acid degradation
kpn00072  Synthesis and degradation of ketone bodies
kpn00280  Valine, leucine and isoleucine degradation
kpn00310  Lysine degradation
kpn00362  Benzoate degradation
kpn00380  Tryptophan metabolism
kpn00620  Pyruvate metabolism
kpn00630  Glyoxylate and dicarboxylate metabolism
kpn00640  Propanoate metabolism
kpn00650  Butanoate metabolism
kpn00900  Terpenoid backbone biosynthesis
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
kpn01212  Fatty acid metabolism
kpn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPN_01693
   00630 Glyoxylate and dicarboxylate metabolism
    KPN_01693
   00640 Propanoate metabolism
    KPN_01693
   00650 Butanoate metabolism
    KPN_01693
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_01693
   00072 Synthesis and degradation of ketone bodies
    KPN_01693
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPN_01693
   00310 Lysine degradation
    KPN_01693
   00380 Tryptophan metabolism
    KPN_01693
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPN_01693
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN_01693
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPN_01693
Enzymes [BR:kpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPN_01693
Exosome [BR:kpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN_01693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABR77124
UniProt: A6T953
Position
complement(1872793..1873983)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgcggctccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggagcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaacgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgattctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system