KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02476Help
Entry
KPN_02476         CDS       T00566                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00340  Histidine metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01230  Biosynthesis of amino acids
Module
kpn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    KPN_02476 (hisD)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     KPN_02476 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABR77894
UniProt: A6TBC3
Position
2700678..2701982
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNGCSADQQQQLLTRPAISASDSISKTVTEILNNVKANGDAALREYSAKFDK
TTVAALQVSEAEIAAAGERLSDELKQAMAVAVKNIETFHNAQQLQAVDVETLPGVRCQQV
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQQVVLCSPPPIADEILYAAQLCGVKT
IFNVGGAQAIAALALGTESVPKVDKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGANPDFVASDLLSQAEHGPDSQVILLTPDADMGSRVAEAVERQLAALPRAETARV
ALSASRIIVARDLAQCVAISNQYGPEHLIIQTRQARELVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSRDGFAALASTIEILAAAERLDAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacacaatcatcgactggaacggctgtagcgcagaccaacaacagcaactc
ttaacgcgcccggcgatttccgcctccgacagcatcagtaaaacggtgacggagatcctg
aataacgtcaaagccaacggcgacgcggcgctgcgcgaatacagcgcgaagtttgataaa
accaccgtcgccgcgctgcaggtgagcgaggcggagatcgccgccgccggcgagcgcctc
agcgatgagctgaagcaggcgatggcggtggcagtgaaaaacatcgagaccttccacaac
gcgcaacagctgcaggcggtggatgtcgaaacgctgccgggggtgcgctgccagcaggtc
acccgtcctatcgcctccgtcggactgtacattcccggcggctcagcgccgctgttctcc
acggtgctgatgctggcgacgccggcgcgcatcgccggctgtcagcaggtggtgctctgc
tcgccgccgccgattgccgatgagatcctctatgccgcgcagctgtgcggcgtaaaaacc
atctttaacgtcggcggcgcccaggccatcgccgccctcgccctcggtaccgagtcggtg
ccgaaggtggataaaatctttggcccgggcaacgcttacgtcacggaagccaaacgccag
gtcagccagcgtctggacggcgcagctatcgacatgccggccggcccgtcggaagtgctg
gtcatcgccgacagcggcgccaacccggactttgtcgcctccgacctgctgtcgcaggcg
gaacacggcccggactcgcaggtgatcctcctgaccccggacgccgacatgggcagccgc
gtcgccgaagccgtggagcgccagctggccgcccttccgcgcgccgaaactgcccgcgtg
gcgctctccgccagccggatcatcgtggcccgcgatctggcgcagtgcgtggctatctcc
aaccagtacggcccggagcacttgatcattcagacccgtcaggcccgcgagctggtggac
agcatcaccagcgccggttccgttttccttggcgactggtcaccggaatccgcgggcgac
tacgcctcgggcaccaaccacgtcctgccgacctatggttacaccgccacctgctcaagc
ctcggcctggccgacttccagaagcggatgaccgtgcaggagctgtcgcgcgacggcttt
gccgccctcgcctcaacgattgagatcctggccgccgccgagcgccttgacgcccacaaa
aacgccgtaacgctgcgcgttgccgccctgaaggagcaagcatga

DBGET integrated database retrieval system