KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02723Help
Entry
KPN_02723         CDS       T00566                                 

Gene name
yfcX
Definition
(GenBank) bifunctional fatty acid oxidation complex protein: putative enoyl-CoA hydratase/isomerase/putative NAD(P)-binding dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00071  Fatty acid degradation
kpn00280  Valine, leucine and isoleucine degradation
kpn00281  Geraniol degradation
kpn00310  Lysine degradation
kpn00362  Benzoate degradation
kpn00380  Tryptophan metabolism
kpn00410  beta-Alanine metabolism
kpn00640  Propanoate metabolism
kpn00650  Butanoate metabolism
kpn00903  Limonene and pinene degradation
kpn00930  Caprolactam degradation
kpn01040  Biosynthesis of unsaturated fatty acids
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
kpn01212  Fatty acid metabolism
Module
kpn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPN_02723 (yfcX)
   00650 Butanoate metabolism
    KPN_02723 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_02723 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    KPN_02723 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPN_02723 (yfcX)
   00310 Lysine degradation
    KPN_02723 (yfcX)
   00380 Tryptophan metabolism
    KPN_02723 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPN_02723 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPN_02723 (yfcX)
   00281 Geraniol degradation
    KPN_02723 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN_02723 (yfcX)
   00930 Caprolactam degradation
    KPN_02723 (yfcX)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPN_02723 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPN_02723 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPN_02723 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABR78140
UniProt: A6TC19
Position
complement(2992473..2994617)
Genome map
AA seq 714 aa AA seqDB search
MDTVSAFKLEVRADKIAVITIDAPGEKMNTLKAEFGSQVRGLIRQLRDDKSVRGVVFISA
KADNFIAGADINMIARCRSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELA
LACHGRICSDDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMMLTGKQLRPRQAL
KAGLVDEVVPQAILLQAAVELALKGRPTSREVPVRERVLAGPLGRHLLFQFVGKQTQRKT
QGNYPAVKRILQVVENGLAHGCSSGYAEEARAFGELAMSPQSQALRSIFFASTDLKKDPG
AEAGPGSLRSVAVLGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLNKQV
RQRRLRPVERDRQMALISGTTDYQGFAHRDVVIEAVFEDLALKQRMVSEVEQYGGPQTIF
ASNTSSLPIGDIAAHASRPGQVIGLHFFSPVEKMPLVEMIPHKGTDPQTIATVVQLAKRQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLVEGEPIEVIDNALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLESAFGERFSPPANIIDAILKDDRKGRKNNRGFYLYETKGRKSKKRPDPA
VYPLLGIGRPQSRLSAQQVAERCVMMMLNEAARCFDEQIIRSARDGDIGAVFGIGFPPFL
GGPFRYMDTIGAGEVAAILQRLAAQFGPRFTPCDTLLRMAEQGTTFWPADERLT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggatactgtttccgcttttaagcttgaggtccgtgcggacaaaatcgcggtgatcacc
attgatgccccgggtgaaaaaatgaataccctgaaagccgaatttggcagtcaggtacgg
ggattgatacgccagttacgtgacgataagtcagtgcgcggcgtagtatttatctccgcc
aaagcggataactttatcgccggcgctgatatcaacatgattgcccgctgccgcagcgcg
caggaggcggaagcgctggcgcgccagggacagcagattatggctgagatccatggcctg
tcgatcccggtgattgccgctatccacggcgcctgccttggcggcggtctggagctggcg
ctggcctgtcatggccgtatctgtagcgatgacgaaaaaacccgactcggcttgccggag
gtacagcttggcctgctgccgggttccggcgggacgcagcgtttaccgcggctgatcggg
gtcagcaccgcgctggatatgatgctcaccggcaagcagctgcggccgcgacaggcgctg
aaggccggtctggtggacgaggtggtgccgcaggcgattttactgcaggcggcggtggag
ctggcgctgaagggacgaccgaccagccgggaggtgcctgttcgtgaacgcgtactggca
gggcccctggggcgccatctgttattccagtttgtcggtaaacaaacgcagcgcaaaacg
cagggaaattacccggcggtgaagcgaatcttgcaggtcgtcgagaatggtctggcccat
ggctgcagcagcggatacgctgaagaggcgcgcgcatttggcgaactggcgatgagccct
cagtcgcaggcgctgcgatcgatcttctttgccagtaccgatctgaaaaaagaccctggc
gccgaggcgggccccggttcgctgagaagcgttgcagtactgggcggtggcttgatgggc
ggggggatcgcctatgtgaccgcctgtaagggtgggctgccggtgcggattaaagatatc
cagccgcgtggcatcaaccacgccttaaagtacagctgggatctgctgaataaacaggtt
cgtcagcgtcgactgcgcccagtggagcgcgatcgtcagatggcgctgatctccggcact
accgactatcagggctttgctcatcgcgatgtggtgatcgaggcggtatttgaagacctg
gctctcaaacagcggatggtcagcgaagtggaacaatacggcgggccgcagaccatcttt
gcgtcgaatacctcatcgttgccaatcggcgatattgccgctcacgccagccgcccgggg
caggtaatcggcctgcattttttcagtccggtggaaaaaatgccgctggttgagatgatc
ccgcacaagggaaccgacccgcagactatcgccaccgtggtgcagctggctaaacggcag
gggaaaacgccgattgttgtcgcagataaagcggggttctatgtgaaccgtatcctcgcg
ccgtatatcaatgaagcgatgcgcctgctggtggaaggcgaaccgattgaagtcattgat
aacgcgttggttaaattcggtttcccggtggggccgattcaactgctggatgaggtgggt
atcgataccggcaccaaaattatccctgtgctggagagcgcgtttggagaacgttttagc
ccgcctgcaaacatcattgacgcgattttgaaggacgatcgcaaaggcagaaaaaataat
cgtggtttctatctttatgagacaaaagggcgtaaaagcaaaaaacggcccgacccggca
gtctatccgctgctcggcatcggccgcccgcagtcgcggctctccgcgcagcaggtggcg
gagcgctgtgtgatgatgatgcttaacgaagcggcgcgctgctttgatgagcagattatc
cggagcgcgcgcgatggcgatatcggcgccgtctttggtatagggtttccgccatttctt
ggcggcccgttccggtatatggatactatcggcgcgggtgaagttgccgcgatcctgcag
cgcctggccgcccagttcggcccacgttttacaccctgtgacactttattacgcatggcc
gaacaggggaccaccttttggccagcggatgaacggctgacctaa

DBGET integrated database retrieval system