KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02805Help
Entry
KPN_02805         CDS       T00566                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00300  Lysine biosynthesis
kpn01100  Metabolic pathways
kpn01120  Microbial metabolism in diverse environments
kpn01230  Biosynthesis of amino acids
Module
kpn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KPN_02805 (dapE)
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KPN_02805 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABR78215
UniProt: A6TC94
Position
3076277..3077404
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQNFWAWRGHGET
LAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQYPN
HRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIANVQSGT
GSNNVIPGDMFVQFNFRFSTELTDEMIKSRVIALLEKYQLRYRLEWWLSGQPFLTGRGKL
VDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRVMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcccggtcattgagctggctcagcagcttattcgccgcccttcccttagcccc
gatgatgcgggatgccaggcgttaatgattgaacgcctgcgtgcgatcggctttaccgtt
gaaccgatggatttcggcgatacgcagaatttctgggcctggcgcggccacggcgagacg
ctggccttcgccggccacaccgacgtagtcccggcaggcgacgccgaccgctggatcaat
cccccgttcgaaccgaccatccgcgacgggatgctgtttggccgcggagcggcggatatg
aaaggctcgctggcggcgatggtggttgccgcagagcgttttgtcgcgcagtacccgaac
cacaggggccgactggcgtttttgatcacctctgatgaagaggccagcgccaaaaacggc
accgtcaaagtggtggagacgctgatggcgcgtaacgagcgtctggactattgtctggtc
ggcgaaccttccagtaccgaagtggtcggcgatgtggtgaaaaacggccgccgcggctcg
ctgacctgcaacctgactattcacggcgtgcaggggcatgtcgcctatccgcaccttgcc
gataaccctgtccaccgcgcggcgccgatgctggcggaactggtcaatatcgagtgggat
aaaggcaatgagttcttcccgccgaccagcatgcagatcgccaacgtgcagtccggcacc
ggcagcaataacgtgatccccggcgatatgttcgtccagttcaacttccgcttcagtacg
gagctgacggacgagatgatcaaatcccgggtgatcgccctgctggaaaaataccagctg
cgttacagactggagtggtggctctccggccagccgtttctcaccggacggggcaagctg
gtggatgcggtcgtcaacgcgattgagcactataatgagatcaaaccgcagctgttaacc
aacggcggcacctcagacggacggtttatcgcgcgcatgggggcgcaggtggttgagctg
ggccccgtaaacgcaacgattcacaaaattaatgaatgtgtgaacgccgccgacctgcag
ctgctggcgcggatgtatcaacgcgtcatggaacagctggtcgcctga

DBGET integrated database retrieval system