KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_03168
Entry
KPN_03168         CDS       T00566                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_03168
Secretion system [BR:kpn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN_03168
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ABR78566
UniProt: A6TD95
Position
3476167..3477507
AA seq 446 aa
MKIHRPLWAEGTFLSSQQFQQQARWETYSNNSIAQLGIRHPWGVARVEFDREALALGKLK
LRTLRLRFSDGSLIDSEVSDALPLACDLHTLAVENTAIVVLALPLEHANGGNLGQEKHTE
RPLRYRQEWHKVQDIYGSDSEEMAVECHALSLRFAHDNNQDYITCPLARLTRNGQGNWSQ
DESYIPPLLALSAHIGLVERLDTLLLQLQAKCRRLMALRRESNQRMADFAVADVSLFWLL
NALNSAEPVLSDFLRYPSIHPELVWRELARLAGALLTFSLEHNVSAIPAYVHDAPASVFP
PLFTLLSELLEASLPSRVIALELESLPGNRWKAELHDPRLREEADFYLSVRSSLPTHVVL
QQLPRLCKIGAPDDVTLLVNVALNGVPVVPLTQVPAALPLRLENQYFALDMQSAPAKAML
DAGCCMIYAPGTLGDLKPELFAVLRS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaaattcatcgaccactatgggctgagggaacgttcctgtcctcacaacagtttcag
cagcaggcccgctgggaaacgtacagtaacaacagcattgcacagctgggtatccgtcat
ccatggggtgtggcgagagtcgagtttgacagagaagcgttggcgttagggaagttaaaa
ttacgtaccctgcgcctgcgtttttccgatggctcgttgatcgactccgaagtttccgat
gcgctgcctctggcttgtgatttacatactctggcggtggaaaatacggcaatagttgtc
ctggcgttaccgctggaacatgcgaatggcggtaatctgggacaggaaaagcatactgaa
agacccctgcgttatcgtcaggaatggcataaagtacaggatatttatggcagcgacagt
gaagaaatggccgttgaatgccatgcgctgtcattgcgtttcgcccatgataacaatcag
gattacatcacctgcccgcttgcacgtctgacgcggaatggtcagggtaactggtctcag
gatgaaagctacatcccgccgctgcttgccctcagcgcacatattggtctggtggagcga
ctggatacgttgctgttgcagctacaagcgaagtgccggcgtctgatggccctgcgccgg
gaaagcaatcagcgtatggcggacttcgcggtagcggatgtgtccctgttctggttactc
aatgcgttgaacagcgctgaaccggttctaagtgattttttacggtatccgagcatccat
cctgaactcgtctggcgcgaactggctcgtctggccggcgcgttgctgaccttttccctt
gaacacaacgtgagcgccattcccgcatatgtccatgatgctccagcctccgtttttccg
ccgctttttaccctgctcagcgaactgctcgaagccagcctgccgtcgcgggtgattgcg
ctcgagctggaatcccttcccggcaaccgctggaaagccgaacttcacgatccacgcctg
cgggaagaggcggatttttacctttctgttcgctcctcgctgccgacgcacgtcgttctg
caacagttaccacggctctgcaaaatcggggcgccggatgacgttacgttgttggttaat
gttgcgctgaacggtgtccctgttgttccgctgacgcaggttccggctgcattgccatta
cggctggagaatcagtactttgcgctggatatgcagagcgctccggctaaagccatgctg
gatgccgggtgctgcatgatttacgcgccgggtacgctgggcgatctgaaacccgagctt
tttgcggtactgcggtcatga

DBGET integrated database retrieval system