KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03545Help
Entry
KPN_03545         CDS       T00566                                 

Gene name
fruA
Definition
(GenBank) PTS family enzyme IIB'BC, fructose-specific
  KO
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00051  Fructose and mannose metabolism
kpn01100  Metabolic pathways
kpn01120  Microbial metabolism in diverse environments
kpn02060  Phosphotransferase system (PTS)
Module
kpn_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPN_03545 (fruA)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    KPN_03545 (fruA)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     KPN_03545 (fruA)
Transporters [BR:kpn02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    KPN_03545 (fruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB PTS_EIIC PTS_EIIC_2
Motif
Other DBs
NCBI-ProteinID: ABR78940
UniProt: A6TEF6
Position
3906956..3908368
Genome map
AA seq 470 aa AA seqDB search
MKKIIAVTGCPTGIAHTFMAEEALKTAAKKLNVEIKVETNGASGVENAITPEDLKDIYGV
IIAADKDVNAERFNGLPVIEVPVKEAIHHPAELINKVVNGQAPRRQGFSAATDPDEKYER
ESFGRQIYKHLMSGVSNMLPFVVAGGILIAVSFLWGIYSADPNSPQYNVIAATLMKVGQQ
AFSIMVPVFTAYIAWSISGRPGMVAGFVGGLLANATGAGFLGGIIAGFAAGYFMLLIRHL
LDGLPRQYEGLKSIFIMPLIGVLVIGVMMVLLGQPVAAINNGMMNWLSSLQEANPILLGI
VVGAMCSFDFGGPVNKAAYVTGTLLLGQGNYFFMAGVSAACITPPLVIALATTFFPKGFS
EEERAAGMVNYILGCTHITEGAIPFAAKDPLRVIPMMMIASSISAVLSYSLHIQVPAPHG
GFLILPLVSKPLMWVLCILAGSACGALMLGCWRLWQKRTDKATALAGAMK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgccgtgaccggctgccctacaggtattgctcatacatttatggct
gaagaggccttaaaaaccgcagcgaaaaaattaaacgttgaaataaaagtcgaaaccaat
ggcgcttccggcgtagaaaacgccattacgccggaagacctgaaggatatttatggcgtg
attatcgctgccgataaagatgttaatgccgaacgttttaatggtttaccggttattgag
gtgccggttaaagaagccattcatcatccggcggaattaattaataaagtcgttaacggt
caggcgccgcgtcgtcagggattctccgcggcaacggatccagacgagaaatatgagcga
gaatcgttcggccgacagatttacaaacatctgatgagcggcgtttccaacatgctaccg
ttcgttgtcgccggcgggatcttaatcgctgtatctttcttatggggcatctactccgcc
gacccgaattcaccgcagtataacgtgattgccgccacgctgatgaaagtcggtcagcag
gcgttctcgatcatggtgccggtgtttaccgcctacattgcctggtcgatatctggccgc
cctggcatggttgccggttttgtcggcggtctgctggcgaacgccaccggcgccgggttt
ctcggtgggatcatcgccggttttgccgccggatattttatgctgctgatccgtcatctg
ctcgacggtctgccgcgccagtacgaagggctgaagtcgatctttattatgccgctgatc
ggcgtcctggtgatcggcgtgatgatggttctgctcggccagccggtggcagcgatcaac
aatggcatgatgaactggctcagctctttacaggaagccaacccaatcctgctggggatc
gtggtaggcgcaatgtgctccttcgacttcggcgggccggtcaacaaagcggcctatgtc
accggtacgttgctgctgggtcaaggtaactacttctttatggccggtgtatctgccgcc
tgcatcacgccgccgctggtcatcgctctggcgaccacgttctttccgaaaggctttagc
gaggaggaacgcgccgccgggatggtcaactatatcctcggctgcacacacattaccgaa
ggtgcaattccctttgccgccaaggatccgctgcgggtgatcccgatgatgatgatcgcc
tcctcaatttctgcggtactcagctacagcctgcatattcaggttccggcaccgcacggc
ggcttcttaatcctgccgctggtcagtaaaccgttgatgtgggtgctgtgcattctcgcc
ggttccgcctgcggggcacttatgctgggatgctggcggctgtggcaaaaacgcactgac
aaagcgacagctcttgctggcgccatgaaataa

DBGET integrated database retrieval system