KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03599Help
Entry
KPN_03599         CDS       T00566                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00520  Amino sugar and nucleotide sugar metabolism
kpn00550  Peptidoglycan biosynthesis
kpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KPN_03599 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPN_03599 (murA)
Enzymes [BR:kpn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     KPN_03599 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:kpn01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   KPN_03599 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABR78992
UniProt: A6TEK8
Position
complement(3958610..3959869)
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTRLQGEVTISGAKNAALPILFSALLAEEPVEIQNVPKLKDIDTTMKLLSQL
GAKVERNGSVWIDAGPVDVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGAR
PVDLHISGLEQLGAEIKLEEGYVKASVSGRLKGAHIVMDKVSVGATVTIMSAATLAEGTT
IIENAAREPEIVDTANFLNALGAKITGQGSDRITIEGVQRLGGGVYRVLPDRIETGTFLV
AAAISGGKILCRNAQPDTLDAVLAKLRDAGADIETGEDWISLDMHGNRPKAVNVRTAPHP
GFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHIPELIRMGAHAEIESNTAICHGVKQL
SGAQVMATDLRASASLVLAGCIAEGTTIVDRIYHIDRGYERIEDKLQALGANIQRVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaattccgtgttcaggggccgactcgccttcagggtgaagtcaccatctccggg
gcaaaaaacgccgccctgccaatcctcttttccgcgctgcttgccgaagagccggtagag
atccaaaacgtacctaagctgaaagacatcgataccaccatgaagctgctgagccagctg
ggcgcgaaggtcgagcgcaatggttcggtatggattgacgccggcccggtcgatgtattc
tgtgctccgtacgatctggtgaaaaccatgcgcgcctctatctgggcgctgggcccgttg
gtggcgcgtttcggtcaggggcaagtttctctgcctggcggctgcgctatcggcgcgcgt
ccggtcgatctgcatattagcggtctggagcagctgggcgccgagatcaaactggaagaa
ggttatgtcaaagcctcggtcagcggtcgcctgaaaggcgcgcatattgtgatggataag
gtgagcgtcggcgccaccgtaaccatcatgagcgcagcgacgcttgcggagggaacgacg
attattgaaaacgccgctcgcgagccggagattgtcgataccgccaacttcctgaacgcg
ctgggcgcaaaaatcacaggccagggtagcgatcgcattaccatcgaaggcgtgcagcgc
ctgggcggcggcgtctaccgtgtgctgcctgaccgtattgaaaccgggactttcctggtg
gccgcggcgatttccggcggcaagatcctctgccgtaacgcgcagccggataccctggat
gccgtactggcgaagctgcgcgacgccggggctgacatcgaaacgggcgaagactggatc
agcctcgatatgcacggcaaccgtccgaaagcggtcaacgtgcgtaccgcgccgcacccg
ggcttcccgaccgatatgcaggcccagttcacgctgcttaacctggtagcggaagggacc
ggcgtgatcaccgaaacgatctttgaaaaccgcttcatgcacattccggagctgatccgt
atgggcgcgcacgcggagatcgagagcaataccgctatctgtcacggcgtgaagcagctt
tctggcgcgcaggtgatggcgaccgatttgcgcgcgtcggcgagcctggtgctggccggc
tgtatcgctgaagggaccaccatcgtcgatcgcatctatcatatcgatcgcggctatgag
cgtatcgaagataaactgcaggcgctgggcgccaatattcaacgcgtgaagggcgagtaa

DBGET integrated database retrieval system