KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_03915Help
Entry
KPN_03915         CDS       T00566                                 

Gene name
tkrA
Definition
(GenBank) 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00030  Pentose phosphate pathway
kpn00260  Glycine, serine and threonine metabolism
kpn00620  Pyruvate metabolism
kpn00630  Glyoxylate and dicarboxylate metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPN_03915 (tkrA)
   00620 Pyruvate metabolism
    KPN_03915 (tkrA)
   00630 Glyoxylate and dicarboxylate metabolism
    KPN_03915 (tkrA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN_03915 (tkrA)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     KPN_03915 (tkrA)
    1.1.1.81  hydroxypyruvate reductase
     KPN_03915 (tkrA)
    1.1.1.215  gluconate 2-dehydrogenase
     KPN_03915 (tkrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABR79301
UniProt: A6TFG7
Position
4292528..4293499
Genome map
AA seq 323 aa AA seqDB search
MKPSVILYKTLPDDLLQRLEEHFSVTQVKNLRPETVSQHAEAFAQAEGLLGSSEKVDAAL
LEKMPKLRATSTVSVGYDNFDVEALNARRVLLMHTPTVLTETVADTVMALVLSTARRVVE
VAERVKAGEWTKSIGPDWFGTDVHHKTLGIVGMGRIGMALAQRAHFGFGMPILYNARRQH
PQAEERFNARYCDLDTLLQEADFVCLILPLSEETHHLFGQAQFAKMKSSAIFINAGRGPV
VDEQALIAALQNGEIHAAGLDVFEHEPLAKDSPLLSLPNVVALPHIGSATHETRYNMAAC
AVDNLIDALNGNVEKNCVNPQVK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtctgtcattctctataaaacgcttcccgacgacctgctacagcgtctggag
gagcacttttccgtcactcaggtgaaaaacctgcggccggagaccgtttcgcagcacgct
gaggccttcgcccaggctgaaggcctgctgggctccagcgaaaaggttgacgccgcgctg
ctggagaagatgccgaagctgcgtgcgacctccaccgtttccgttggctatgacaacttc
gacgtcgaggcgctgaacgcccgccgggtgctgctgatgcataccccgaccgtgctgacc
gagaccgtcgccgatacggtcatggcgctggtgctgagtaccgcgcgtcgggtagtggaa
gtggcggagcgcgtcaaagcgggtgaatggacgaagagcattggtccggactggttcggc
acggatgttcaccataaaaccttaggcatcgtcggcatgggccgcatcggtatggcgctg
gcgcagcgcgcccacttcgggttcggcatgccgatcctgtataacgcgcgtcgccagcat
ccgcaggcggaagaacgcttcaatgcccgctattgcgatctcgataccctgctgcaggag
gctgactttgtctgcctgatcctgcccctgagcgaagagactcaccatctgttcggtcag
gcgcagtttgccaaaatgaaatcttccgccatcttcattaacgccgggcgtggcccggta
gtggacgagcaggcgctgatcgccgccctgcagaacggtgagatccacgctgccggtctc
gatgtgttcgaacacgaaccgctggccaaggactcaccgctgctgagcctgccgaacgtc
gtcgcgctgccgcatatcggctccgccacccatgagacgcgctacaacatggcggcctgt
gcggtggacaacctgatcgacgccctgaacggcaacgtagagaaaaactgcgtcaatccg
caggtaaaataa

DBGET integrated database retrieval system