KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_04175Help
Entry
KPN_04175         CDS       T00566                                 

Gene name
hemN
Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00860  Porphyrin and chlorophyll metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPN_04175 (hemN)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     KPN_04175 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ABR79554
UniProt: A6TG70
Position
4573628..4575001
Genome map
AA seq 457 aa AA seqDB search
MSEQIIDWDLALIQKYNYSGPRYTSYPTALEFSPQFGAAEFDAAVARYPQRPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDVLEQEIIHRAPLFATRQVKQLHWGGGTPTYLNK
AQISRLMDLLRSHFHFSAEAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEAFIFDLLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLQKVAELNPDRLSVF
NYAHLPTLFAAQRKIKDADLPSAEQKLEILQETIGSLTTAGYQFIGMDHFARPDDELAVA
QRHGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDSYAQNQKELKQYYQQVAEQGNALWRG
IALTRDDCLRRDVIKALICNFQLDIAAVEAQWDVDFASYFAEDLKLLAPLAHDGLVAVDD
KVIQVTAKGRLLIRNICMCFDAYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcagataatcgactgggatctggccctgatccagaaatataactattccggg
ccgcgctatacctcgtatcccaccgcgctggagttttcaccgcaatttggcgcggcggaa
ttcgatgccgctgtggcccgttacccacagcgtcccctgtcgctgtacgtgcatatccca
ttttgccataagctgtgttatttctgcggctgcaataagatagtcacccgccagcagcat
aaggccgatcaatatctcgatgtccttgagcaggagatcatccaccgcgcgccgctgttt
gccactcgccaggtgaagcaactgcactgggggggcggcacgccaacttatctcaataag
gcgcaaatcagtcgcctgatggatctgttgcgcagccattttcatttcagcgcggaagcc
gagatctccattgaggtcgatccgcgtgaaatcgagctggatgtcctcgatcatttacgc
gctgagggtttcaaccgcctgagtatgggcgtacaggacttcaataaagaggttcagcgt
ctggttaaccgtgagcaggacgaagcgttcatctttgatttgctcaaccatgcgcgggag
attggttttacctcgaccaatatcgacctcatttatggcctgccgaagcaaacgccggag
agcttcgcctttaccctgcaaaaggtcgccgagctcaatcctgaccgcctgagcgtgttt
aactatgcgcatctgcccacgctctttgccgctcagcggaagattaaagatgccgatctg
ccctccgctgagcagaagctggagatcctgcaggaaaccatcggctcgctgacgacggca
ggctatcagtttatcggcatggaccatttcgcccgtcccgatgatgaattagcggtcgcg
caacgtcacggcgtactgcatcgtaatttccagggctacaccactcagggcgataccgat
ctgctggggatgggcgtttcggcgatcagcatgattggcgacagctacgcccagaaccaa
aaagagctcaagcagtactaccagcaggtagcagagcaagggaacgccctgtggcgcggg
atcgcgttaactcgcgatgactgtctgcgtcgcgacgtgattaaggcgttgatctgtaac
ttccagctggatatcgcggcggtcgaggcgcagtgggacgtggattttgcgtcttatttc
gccgaggatctgaagctgctggcgccgctggcgcatgacgggctggtggctgtggatgat
aaggtcattcaggtgacggcgaaaggccgcctgctgatccgcaacatctgtatgtgcttt
gatgcctacctacggcaaaaggcccgaatgcagcagttctcacgggttatttaa

DBGET integrated database retrieval system