KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_04363Help
Entry
KPN_04363         CDS       T00566                                 

Gene name
rplJ
Definition
(GenBank) 50S ribosomal protein L10
  KO
K02864  large subunit ribosomal protein L10
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KPN_04363 (rplJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kpn03011]
    KPN_04363 (rplJ)
Ribosome [BR:kpn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KPN_04363 (rplJ)
  Bacteria
    KPN_04363 (rplJ)
  Archaea
    KPN_04363 (rplJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L10 DUF349
Motif
Other DBs
NCBI-ProteinID: ABR79722
UniProt: A6TGN8
Position
4768823..4769320
Genome map
AA seq 165 aa AA seqDB search
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL
RRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA
SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaatcttcaagacaaacaagcgattgttgctgaagtcagcgaagtagccaaa
ggcgcgctgtctgcagtagttgcggattcccgtggcgtaactgtagataaaatgactgaa
ctgcgtaaagcaggtcgtgaagctggcgtatacatgcgtgttgttcgtaacaccctgctg
cgccgcgtcgttgaaggtactcagttcgagtgcctgaaagacacgtttgttggtccgacc
ctgattgcatactctatggaacacccgggcgctgctgctcgtctgttcaaagagttcgcg
aaagcgaatgcaaaatttgaggtcaaagccgctgcctttgaaggtgagctgatcccggcg
tcgcagatcgaccgcctggcaactctgccgacctacgaagaagcaattgcacgcctgatg
gcaaccatgaaagaagcttcggctggcaaactggttcgtactctggctgctgtacgcgat
gcgaaagaagctgcttaa

DBGET integrated database retrieval system