KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_04406Help
Entry
KPN_04406         CDS       T00566                                 

Gene name
manX
Definition
(GenBank) PTS enzyme IIAB, mannose-specific
  KO
K02812  sorbose PTS system EIIA component [EC:2.7.1.206]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00051  Fructose and mannose metabolism
kpn01100  Metabolic pathways
kpn02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPN_04406 (manX)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KPN_04406 (manX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpn02000]
    KPN_04406 (manX)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     KPN_04406 (manX)
Transporters [BR:kpn02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    KPN_04406 (manX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: ABR79761
UniProt: A6TGS7
Position
complement(4823229..4823636)
Genome map
AA seq 135 aa AA seqDB search
MVHAIFCAHGQLAGAMLDSVRMVYGEVNVSAVAFVPGENAANIAINLEKLVSAHTDEEWV
IAVDLQCGSPWNAAAGLAMRHPQIRVISGLSLPLALELVDNQHTLSADDLCQHLQAIASQ
CCVVWQQPETVEEEF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgctatcttctgcgctcacggccagctggccggggccatgctcgattcggta
cgcatggtctacggcgaggttaacgtcagcgccgtcgcgtttgtccccggcgaaaacgcg
gcgaatatcgccattaacctggaaaagttagtaagcgcccacaccgatgaggagtgggta
atcgcggtagatttgcagtgcggaagcccatggaatgccgcagccgggctggcaatgcgt
cacccgcagatccgggtgattagcggcctgtcgctgccgctggcgctcgagctggtggat
aaccagcataccctgagcgccgatgacttatgccagcatctgcaggccatcgccagtcag
tgctgtgtggtctggcagcagccagaaaccgttgaggaggagttctga

DBGET integrated database retrieval system