KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04478Help
Entry
KPN_04478         CDS       T00566                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00010  Glycolysis / Gluconeogenesis
kpn00620  Pyruvate metabolism
kpn00640  Propanoate metabolism
kpn00680  Methane metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_04478 (acs)
   00620 Pyruvate metabolism
    KPN_04478 (acs)
   00640 Propanoate metabolism
    KPN_04478 (acs)
  Energy metabolism
   00680 Methane metabolism
    KPN_04478 (acs)
Enzymes [BR:kpn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KPN_04478 (acs)
Lipid biosynthesis proteins [BR:kpn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KPN_04478 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABR79833
UniProt: A6TGZ9
Position
complement(4900926..4902884)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPDQYKAQYQQSITDPDTFWGEQGKILDWMRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVKSIEHVVVLKRTGGNIDWQEGRDLWWSDL
IANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacaccctattcccgctaatattgcggaacgttgcctgattaac
ccggatcagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatgcggccctatacccgtgtaaagaacacctccttc
gcaccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgctaac
tgtctcgaccgccacctcgccgaacgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccaaagcaagcacatcacctaccgtgaactgcatgccgacgtgtgccgtttc
gccaatgtgctgctcgacctcgggattaaaaaaggcgacgtggttgctatctatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggggcaatccactcg
gtcattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctca
cgcctggtgatcaccgctgacgaagggctgcgtgccggtcgcgccatcccgctgaagaaa
aacgtcgatgacgcgctgaaaaacccgaacgtgaaaagcattgagcacgtggtggtcctg
aaacgcaccggcggcaatatcgactggcaggaaggccgcgatctgtggtggagcgacctg
attgcgaacgccagcgccgaacaccggcccgtcgaaatgaacgccgaagatccgctgttc
atcctctatacctccggctccaccggtaaaccgaaaggggtgctgcacaccaccggcggc
tatctggtctatgcggccaccacctttaaatacgttttcgactaccatccgggcgatatt
tattggtgcaccgccgacgtgggctgggtcaccggccatagctatctgctgtacggccca
ctggcctgcggcgccaccaccctgatgttcgaaggggtgccgaactggcctacgccggcg
cgcatgtgccaggtcgtcgataagcataaggtcagcattctctataccgccccgacggct
attcgcgccctgatggcggaaggcgacaaagctatcgaaggcacagaccgctcctcgctg
cgcattcttggctcggtcggcgaaccgattaacccggaagcctgggagtggtactggaag
aagatcggtaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcactccgctgccgggcgcgattgagctgaaggccggctccgcgacgcgtccg
ttcttcggcgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gagggcaacctcgccatcgccgactcctggcccggccaggcgcgtaccctgttcggcgac
catgagcgctttgagcaaacctacttctccactttcaaaaatatgtactttagcggcgac
ggcgcgcgtcgtgatgaagatggctattactggatcaccggccgggtggatgacgtcctg
aacgtctccggacaccgtctggggaccgccgagatcgaatcggcgctggtctcacaccca
aaaatcgccgaagcggcggtggtggggatcccgcataacatcaaaggccaggccatctat
gcctacgtgacgctcaatcacggcgaagaaccgacgccggagctgtatgccgaagtgcgt
aactgggtacgcaaagagatcggtccgctggcgacgccggatgtgctgcactggaccgat
tcgctgccgaaaacccgctcgggcaaaatcatgcgccgcattctgcgtaagattgccgca
ggcgacaccagcaacctcggcgatacctcgaccctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccattaccatgccatcgtaa

DBGET integrated database retrieval system