KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_04753
Entry
KPN_04753         CDS       T00566                                 

Definition
(GenBank) putative LACI-type transcriptional regulator
  KO
K02058  simple sugar transport system substrate-binding protein
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpn02000]
    KPN_04753
Transporters [BR:kpn02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter
    KPN_04753
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Other DBs
NCBI-ProteinID: ABR80099
UniProt: A6THR5
Structure
PDB: 
3D02

Position
5211185..5212168
AA seq 327 aa
MHKRLVVNIFSSLLLGAALISAPVYAAEKTVVNISKVDGMPWFNRMGEGVVQAGKEFNLN
ASQVGPSSTDAPQQVKIIEDLIARKVDAITIVPNDANVLEPVFKKARDAGIVVLTNESPG
QPSANWDVEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLTVPQHNLWADLLVKYQKEH
YPDMHEVTRRMPVAESVDDSRRTTLDLMKTYPDLKAVVSFGSNGPIGAGRAVKEKRAKNK
VAVYGMMIPSQAASLIKSGDITEGITYDPATAGYALAAVASTLLNGKTIEPGFELKELGK
AEVDSDKHIIRFHKVLLVNKDNIDSLY
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcataaacgtctggtcgttaatattttttcatccttgctgttgggggctgcgcttatt
tccgcgccggtatatgcggcggaaaaaaccgtagtcaatatttcaaaagtggacggcatg
ccatggtttaaccggatgggtgaaggggtagtccaggccgggaaagagtttaacctcaac
gcctcccaggtagggccgtccagcaccgatgcgccgcagcaggtgaaaattattgaggac
ctgattgcacgtaaagtggatgccatcactatcgtgcctaacgatgccaacgtgctggag
ccggtattcaaaaaagcccgtgacgccggcatcgtggtactgaccaacgaatcgcccggg
cagccgagcgccaactgggatgtggagataatcgataacgagaagttcgctgctgaatac
gtggagcatatggccaagcggatgggtggcaaaggcggctacgttatctatgtcggtagc
cttacggtaccgcagcacaacctgtgggccgatctgctggtgaaataccaaaaagaacat
tacccggacatgcatgaagtcacccgccgaatgccggtggcggaaagtgttgatgattcc
cgccgtaccacgctcgatctgatgaaaacttacccggatctgaaagcggtggtctctttt
ggttcgaatggcccgattggcgcggggcgcgcggtgaaagagaagcgtgcgaaaaataaa
gtcgcggtctacgggatgatgatcccctcgcaggcggcctctcttattaagagcggcgat
attaccgaagggatcacctacgatccggcgacagccggctatgccctcgcggccgtcgcc
agcaccctgctgaacggcaaaaccattgagccgggatttgaactgaaagagctcggtaaa
gcggaggtcgatagcgacaagcatattatccgcttccataaagtgctgctggtaaataaa
gacaatattgattcgctctactaa

DBGET integrated database retrieval system