KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_pKPN3p05892Help
Entry
KPN_pKPN3p05892   CDS       T00566                                 

Definition
(GenBank) Phosphonate dehydrogenase (NAD-dependent phosphite dehydrogenase)
  KO
K18916  phosphonate dehydrogenase [EC:1.20.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPN_pKPN3p05892
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.1  With NAD+ or NADP+ as acceptor
    1.20.1.1  phosphonate dehydrogenase
     KPN_pKPN3p05892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored Rossmann-like ThiF
Motif
Other DBs
NCBI-ProteinID: ABR80271
UniProt: A6TI50
Position
pKPN3:37510..38520
Genome map
AA seq 336 aa AA seqDB search
MLPKLVITHRVHDEILQLLAPHCELVTNQTDSTLTREEILRRCRDAQAMMAFMPDRVDAD
FLQACPELRVVGCALKGFDNFDVDACTARGVWLTFVPDLLTVPTAELAIGLAVGLGRHLR
AADAFVRSGEFQGWQPQFYGTGLDNATVGILGMGAIGLAMAERLQGWGATLQYHEAKALD
TQTEQRLGLRQVACSELFASSDFILLALPLNADTQHLVNAELLALVRPGALLVNPCRGSV
VDEAAVLAALERGQLGGYAADVFEMEDWARADRPRLIDPALLAHPNTLFTPHIGSAVRAV
RLEIERCAAQNIIQVLAGARPINAANRLPKAEPAAC
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgaaactcgttataactcaccgagtacacgatgagatcctgcaactgctggcg
ccacattgcgagctggtgaccaaccagaccgacagcacgctgacgcgcgaggaaattctg
cgccgctgtcgcgatgctcaggcgatgatggcgttcatgcccgatcgggtcgatgcagac
tttcttcaagcctgccctgagctgcgtgtagtcggctgcgcgctcaagggcttcgacaat
ttcgatgtggacgcctgtactgcccgcggggtctggctgaccttcgtgcctgatctgttg
acggtcccgactgccgagctggcgatcggactggcggtggggctggggcggcatctgcgg
gcagcagatgcgttcgtccgctctggcgagttccagggctggcaaccacagttctacggc
acggggctggataacgctacggtcggcatccttggcatgggcgccatcggactggccatg
gctgagcgcttgcagggatggggcgcgaccctgcagtaccacgaggcgaaggctctggat
acacaaaccgagcaacggctcggcctgcgccaggtggcgtgcagcgaactcttcgccagc
tcggacttcatcctgctggcgcttcccttgaatgccgatacccagcatctggtcaacgcc
gagctgcttgccctcgtacggccgggcgctctgcttgtaaacccctgtcgtggttcggta
gtggatgaagccgccgtgctcgcggcgcttgagcgaggccagctcggcgggtatgcggcg
gatgtattcgaaatggaagactgggctcgcgcggaccggccgcggctgatcgatcctgcg
ctgctcgcgcatccgaatacgctgttcactccgcacatagggtcggcagtgcgcgcggtg
cgcctggagattgaacgttgtgcagcgcagaacatcatccaggtattggcaggtgcgcgc
ccaatcaacgctgcgaaccgtctgcccaaggccgagcctgccgcatgttga

DBGET integrated database retrieval system