KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_pKPN3p06021Help
Entry
KPN_pKPN3p06021   CDS       T00566                                 

Gene name
trbC
Definition
(GenBank) F pilus assembly protein
  KO
K12059  conjugal transfer pilus assembly protein TrbC
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_pKPN3p06021 (trbC)
Secretion system [BR:kpn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KPN_pKPN3p06021 (trbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC_Ftype Tox-HNH-HHH
Motif
Other DBs
NCBI-ProteinID: ABR80400
UniProt: A6TIH7
Position
pKPN3:154501..155130
Genome map
AA seq 209 aa AA seqDB search
MNLFMVMLLLTGRAVLAETSSVTDREWLKQQETLSEQLRQHPDKQLQQELEAQINRNPLP
KSDRQFIDNLVSQQKAANQEKPAEGALYFVSFSIPEEGLKRMLHETRQYGIPATLRGLVN
NDMKTTTDAVLQLVKDGVTDGVQIDPTLYTQYSIRSVPSLVVRCQAGYDVVRGNIHVKQA
LEKVAQTGDCAQVARQILDAPSNAAGSQP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtttatggtcatgcttttgctgaccggacgagcggtgttggctgaaacctcc
tctgttacagacagagaatggctgaagcagcaggagaccctcagcgaacagctgcgccag
catccggataaacagctgcagcaggagcttgaggcgcaaatcaaccgtaatcctctgccc
aaatcagaccgccagtttatcgataatctggtcagccagcagaaagcggcgaatcaggaa
aagccagcagaaggggcgctgtactttgtctccttctcgatacctgaagaggggctgaag
cggatgctgcacgaaacccggcagtacggcattccggcgacactgcgtgggctcgtcaat
aacgacatgaagaccaccactgacgcggtgctgcagctggtgaaggatggcgtgaccgac
ggcgtgcagatcgacccgacactgtacacgcagtacagcatccggagtgtgccgtctctg
gtggtacggtgtcaggccggatatgacgtggtacgcggtaacattcacgtcaaacaggcg
ctggagaaagtggcacaaaccggtgactgcgcacaggtggcccggcaaatacttgatgcg
ccctcgaatgccgccgggagccagccatga

DBGET integrated database retrieval system