KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_pKPN4p07127
Entry
KPN_pKPN4p07127   CDS       T00566                                 

Gene name
traA
Definition
(GenBank) F pilin subunit
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
SSDB
Motif
Pfam: TraA
Other DBs
NCBI-ProteinID: ABR80506
UniProt: A6TIT3
Position
pKPN4:74424..74792
AA seq 122 aa
MNAVLSVQGSAVPEKTKPSFLSRVFNKKKALKVAKVALPVAAVAAFFPDAAMATTTATDL
MKSGDATVKGTFGKQSSVVKWVVLAEVVAGGIMYMMTKNVKFLFGFAIISTFITIGMSVA
GY
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaatgctgtattaagtgttcagggctctgctgtccctgaaaaaaccaaaccgtctttt
ctgtctcgcgttttcaataaaaagaaagccctgaaagtcgctaaagttgcgctgccggtt
gctgctgtggcggcgttcttcccggatgctgcgatggccaccaccacggcaaccgacctg
atgaagtccggggatgcgaccgttaaaggcacgtttggtaagcagtccagtgtcgtcaaa
tgggtggttctggcagaagttgtcgccggcggcatcatgtacatgatgaccaaaaacgtg
aagttcctgtttggcttcgcgattatttccacctttatcaccatcggtatgtcggtcgcc
ggttactga

DBGET integrated database retrieval system