KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_pKPN4p07149
Entry
KPN_pKPN4p07149   CDS       T00566                                 
Symbol
traF
Name
(GenBank) F pilus assembly protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpn02044]
    KPN_pKPN4p07149 (traF)
Secretion system [BR:kpn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KPN_pKPN4p07149 (traF)
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: ABR80528
UniProt: A6TII2
Position
pKPN4:89713..90465
AA seq 250 aa
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLAT
LQAATKRSLYEAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSH
YNGTVKNQLAADYAEQRQAISTLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIP
VSVDGVINPMLPDSRTDQGQAEQLGVKFFPAMMLVNPKSGQVKPLSYGFISQDDLAKQFL
YVSSDFKPNF
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcgaacaatacatgccgccatgctggcggggtgcctttgctgcgccctgatgccggct
ttcgccaaagacgcgggctggcagtggtacaacgagaaactgaagccccgtgatgaggac
aggaaagccgtaccagcggcaccaccgccgcaaatggatattctggagaaactcgccaca
ctccaggcggccaccaaacggtcgttgtacgaagccattctgtatccatcgtctgaaaac
ttcgtgaagtatttccggctgcagaactactggacgcagcaggcaggtttgttctcgatg
agtgcgaagaaagccatgctggaaaaccccgaactcgattacaacctgcagtacagccac
tacaacggcacggtaaaaaaccagctcgctgccgactatgccgaacagcgacaggctatc
tccaccctcgcacagcactacggcgtgatgttcttctaccggggccgggaagcgatcgat
ggccagctggtccaggtgattaaaaattttcgcgaaacctatggcctgagcgtgataccg
gtgtcggttgacggagtgattaaccccatgctgcccgacagccggacggaccagggccag
gcagagcagcttggcgtgaagttcttccccgcgatgatgctggttaacccgaaaagtggc
caggtgaagcctctcagttacggctttatcagtcaggacgacctggcgaaacagttcctc
tatgtctccagcgactttaaaccgaatttctaa

DBGET integrated database retrieval system