KEGG   Klebsiella pneumoniae 32192: KU54_005405Help
Entry
KU54_005405       CDS       T03746                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kpne  Klebsiella pneumoniae 32192
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpne03016]
    KU54_005405
Enzymes [BR:kpne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     KU54_005405
Transfer RNA biogenesis [BR:kpne03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    KU54_005405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJB56236
UniProt: A0A0W8ARX2
Position
1054333..1055127
Genome map
AA seq 264 aa AA seqDB search
MLEIIYQDDWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIRKRYHAIVRGWLMEEALLDYPLVEELDRIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTSRYGLVELEPKTGRKHQLRRHLAHLRHPILGDSK
HGDLRQNRSAAEHFGCHRLMLHASELSLTHPFTGEPLTLRAGFDDVWMRALSQFGWRGLL
PLNERVEFADDSGQDEENKVNPGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatctaccaggacgactggctggtggcggtcaacaaaccctcgggctgg
ctggtgcatcgcagctggctcgatcgcgacgagaaagtggtggtgatgcagaccgtgcgc
gaccagatcggtcagcacgtttttaccgctcatcgtctcgaccggcccacctccggcgtg
ctgctgatgggattgtcgagcgaggcgggccggctgctggcgcaacagttcgagcagcac
cagatccggaagcgctaccatgcgatcgtccgcggctggctgatggaagaggcgctgctg
gattacccgctggtagaggagctggatagaatcgccgataagttcgcccgcgaagataaa
gggccgcagccagcggtaacccactaccgcggtctggcgacagtggagatgccagtggcg
actgggcgctatcccacctcgcgctatgggctggtggaactggagccgaaaaccggccgc
aagcaccagctgcgccgtcatctggcccacctccgtcatccgatcctcggcgacagcaag
cacggcgatctgcggcaaaaccgcagcgccgcggaacatttcggctgtcaccgcctgatg
ctgcacgccagcgagctgtcgttaacccatccttttaccggcgagccgctgaccctgcgc
gccggttttgacgacgtctggatgcgcgcgctgtcgcagtttggctggcgcgggcttctc
ccgctaaatgaaagggttgagtttgccgacgacagcggtcaggatgaagagaataaggtc
aatccagggagataa

DBGET integrated database retrieval system