KEGG   Klebsiella pneumoniae 32192: KU54_008290Help
Entry
KU54_008290       CDS       T03746                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00450  Selenocompound metabolism
kpne00970  Aminoacyl-tRNA biosynthesis
kpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KU54_008290 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KU54_008290 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpne01007]
    KU54_008290 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpne03016]
    KU54_008290 (metG)
Enzymes [BR:kpne01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KU54_008290 (metG)
Amino acid related enzymes [BR:kpne01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KU54_008290 (metG)
Transfer RNA biogenesis [BR:kpne03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KU54_008290 (metG)
 Prokaryotic type
   Other AARSs
    KU54_008290 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AJB60279
UniProt: W9BHW1
Position
complement(1653949..1655982)
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFDISYDNYHSTHSDENRELSELIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIDPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSTAELYHFIGKDIVY
FHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFISKRFDGVLAAELADPALYK
TFTDAAESIGEAWDSREFGKAIREIMALADVANRYVDEQAPWVVAKQEGRDADLQAICTM
GLNMFRVLMTWLKPVLPQLAARAEAFLNSELSWDAIQQPLLAHKVNPFKALYNRIEMKQV
EALVEASKEEVKATAAPVTGPLADDPIQETITFDDFAKVDLRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQPLIGRLTVMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDDGAKPGQQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtaacgtgcgccctgccgtacgccaacggctcc
atccacctcggccacatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggtcaacttcatctgcgccgacgacgcccacggcacgccgatcatg
ctcaaagcgcagcagctcggtatcacaccggagcagatgattggcgaaatgagtcaggag
catcagaccgatttcgccggcttcgacatcagctatgataactatcactcgacgcacagc
gacgagaaccgcgagctgtcggagcttatctacacccgcctgaaagagaacggttttatt
aaaaaccgcaccatctctcagctctacgatccggaaaaaggcatgttcctgccggaccgt
tttgtgaaaggcacctgtccgaagtgcaaatctccggaccagtatggcgataactgcgaa
gtgtgcggcgcgacctacagccctaccgagcttatcgacccgaaatcggtggtctccggc
gccacgccggtgatgcgtgactccgagcactttttcttcgacctgccgtcgttcagcgaa
atgctgcaggcgtggacccgcagcggcgccctgcaggagcaggtcgcgaacaagatgcag
gagtggttcgaatccggcctgcagcagtgggacatctcccgcgatgcgccgtacttcggc
ttcgaaattcccaacgcgccgggcaaatatttctacgtctggctggacgcgccgatcggc
tacatgggctccttcaagaacctgtgcgacaagcgcggcgacaccaccagcttcgacgaa
tactggaagaaagattctacggccgagctgtatcactttatcggcaaagacattgtctac
ttccacagcctgttctggccggcgatgctggaaggcagcaacttccgtaagccgactaac
ctgttcgtgcacggctacgtgacggttaacggcgccaagatgtccaagtcgcgcggcacc
tttatcaaggccagcacctggttaaatcatttcgatgccgacagcctgcgctactactac
accgccaagctctcttcacgcatcgatgacatcgacctgaacctggaagatttcgtgcag
cgcgtgaacgccgacatcgtcaacaaggtggttaacctcgcctcacgcaacgccggcttt
atcagcaagcgtttcgacggcgtgctggccgctgagctggccgacccggcgctgtacaaa
accttcaccgacgcggcggaaagcatcggcgaagcatgggacagccgcgagttcggtaaa
gccatccgcgaaatcatggccctcgccgacgtggctaaccgctatgtcgatgagcaggcg
ccgtgggtggtggcgaaacaggaaggccgcgacgccgacctgcaggccatctgcaccatg
ggcctgaatatgttccgcgtgctgatgacctggctgaagccggtcctgccgcagctggcc
gcgcgtgcggaagcgttcctcaacagcgaactgagctgggacgccattcagcagccgctg
ctggcgcataaggtcaatccgttcaaggcgctgtacaaccgtatcgagatgaagcaggtt
gaagccctggtagaagcttctaaagaagaggtgaaagccaccgcggcgccggtcaccggt
ccgctggcggacgatccgattcaggagaccatcacctttgacgatttcgccaaagtcgat
ctgcgcgtggcgctgattgaaaacgcggaattcgtcgagggctccgacaagctgctgcgc
ctgacgctggatctcggcggcgaaaaacgtaacgtcttctccggcatccgctccgcctat
ccggatccgcagccgctgattggccgcctgacggtgatggtcgccaacctggcgccgcgc
aaaatgcgcttcggcatctccgagggcatggtgatggccgccggccctggcgggaaggat
atcttcctgttaagccctgacgacggcgccaagccgggtcagcaggtgaaatag

DBGET integrated database retrieval system