KEGG   Klebsiella pneumoniae 32192: KU54_009630Help
Entry
KU54_009630       CDS       T03746                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
kpne  Klebsiella pneumoniae 32192
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kpne03009]
    KU54_009630 (rrmA)
Enzymes [BR:kpne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     KU54_009630 (rrmA)
Ribosome biogenesis [BR:kpne03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    KU54_009630 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_23 Ubie_methyltran Methyltransf_32 NodS Methyltransf_29 tRNA_U5-meth_tr AdoMet_MTase MTS MetW CMAS Pox_MCEL DLH PrmA
Motif
Other DBs
NCBI-ProteinID: AJB57022
UniProt: A0A060VKL4
Position
1930405..1931199
Genome map
AA seq 264 aa AA seqDB search
MSYSCPLCHAPLSRSDNHYSCPQRHQFDLAKEGYVNLLPVQFKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIAERLRHYAPTDLLDIGCGEGYYTHAFAAIASRSWGLDVSKPAIRAA
AKRYPQVNFCVASSQRLPFSDASFDAVVRIYAPCNAEELARVVRPGGWVITATPGPRHLL
ELKGLIYDEVRLHELKTEAMPGFRLEAQQQLAYPMILTGSEAQALLQMTPFAWRAKAEVH
AALRQQPTFGCQTDFMIHCWQREA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacagttgccccctttgtcacgcgccgctcagccgtagcgacaaccactattcc
tgcccgcagcggcaccagttcgatctggcgaaagaggggtacgtcaatctgctaccggtg
cagttcaagcggtcgcgcgatcccggcgatagcgccgaaatgatgcaggcccggcgggcg
ttcctcgacgccggacattatcagccgctacgggatgctatcgctgagcggctgcgacat
tacgcccctacggatttactggatatcggctgtggcgaggggtattacacccacgcgttt
gccgccatcgccagccgcagctgggggctggacgtgtcgaagccggcgatccgcgcggcg
gcaaaacgctacccgcaggtgaatttttgcgtggcctccagccagcgcctgccattttcc
gacgctagcttcgacgcggtagtgcgcatttacgcgccctgcaacgccgaagagctggcg
cgggtggtgcgtcccggtggttgggtgatcaccgccacgccgggtccccgtcacctactg
gagctgaaagggctgatttacgatgaagttcgcctgcatgagctgaagacggaagcgatg
ccggggttccgcctggaggctcagcagcagctggcttatccgatgatcctgacgggaagt
gaagcgcaggccctgctgcagatgacgccgttcgcatggcgggctaaagccgaagtgcac
gccgcgctgcgtcagcagccgacctttggttgccagaccgattttatgatccactgctgg
cagcgcgaagcgtaa

DBGET integrated database retrieval system