KEGG   Klebsiella pneumoniae 32192: KU54_011170Help
Entry
KU54_011170       CDS       T03746                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00071  Fatty acid degradation
kpne00072  Synthesis and degradation of ketone bodies
kpne00280  Valine, leucine and isoleucine degradation
kpne00310  Lysine degradation
kpne00362  Benzoate degradation
kpne00380  Tryptophan metabolism
kpne00620  Pyruvate metabolism
kpne00630  Glyoxylate and dicarboxylate metabolism
kpne00640  Propanoate metabolism
kpne00650  Butanoate metabolism
kpne00900  Terpenoid backbone biosynthesis
kpne01100  Metabolic pathways
kpne01110  Biosynthesis of secondary metabolites
kpne01120  Microbial metabolism in diverse environments
kpne01130  Biosynthesis of antibiotics
kpne01200  Carbon metabolism
kpne01212  Fatty acid metabolism
kpne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KU54_011170
   00630 Glyoxylate and dicarboxylate metabolism
    KU54_011170
   00640 Propanoate metabolism
    KU54_011170
   00650 Butanoate metabolism
    KU54_011170
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KU54_011170
   00072 Synthesis and degradation of ketone bodies
    KU54_011170
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KU54_011170
   00310 Lysine degradation
    KU54_011170
   00380 Tryptophan metabolism
    KU54_011170
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KU54_011170
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KU54_011170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KU54_011170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpne04147]
    KU54_011170
Enzymes [BR:kpne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KU54_011170
Exosome [BR:kpne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KU54_011170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJB57310
UniProt: A0A0C7KCP9
Position
complement(2243239..2244420)
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPVGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgccgtacgcaccccggtaggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcagcggtggtgcgcggcctgcttgaacgc
tgccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgcttaccgccggc
tgcgggcaaaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccggactgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcggcggccgctatcgccgccgggcgctttcgtgaggagatcgtt
ccggtcagcgtcccgcagggcaaaaagccgccgcgagtcgtgactgacgatgagcaaccg
cgcccggagaccagcgagcagcagctggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcctcgtcgctgaacgacggcgccgcggcggtcctgctg
atgcgcgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccatcggtgatgggcattggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggtcagctgcttgagtgggatagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggcaaccctgtgc
gtcggcggcggccagggcatcgccatgaccctacaacgttaa

DBGET integrated database retrieval system