KEGG   Klebsiella pneumoniae 32192: KU54_015810Help
Entry
KU54_015810       CDS       T03746                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00480  Glutathione metabolism
kpne00590  Arachidonic acid metabolism
kpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    KU54_015810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KU54_015810
Enzymes [BR:kpne01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KU54_015810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AJB58175
UniProt: A0A081LU89
Position
3128648..3129130
Genome map
AA seq 160 aa AA seqDB search
MTPFYQLTATRLRGQPLSMADYAGKVVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIEQTCHVNYGVSFPMFEKVDVNGPAAHPLFRYLKQALPGVLGG
RIKWNFTKFLIGRDGTPLTRFAPFTTPEKMEASIVAALTR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttttatcaattgacggctacccgcctgcgcggccagcccctctccatggct
gactatgctggcaaggtggttctggtggtgaatacggccagccattgtggcttcacaccg
caatacgctggcctggaagcgctctacaaaaagtacgcggctcaggggctggtagtgctt
ggtttcccgtgcaaccagtttggtaagcaggaacccggcggtgcggatgaaatcgagcag
acttgtcacgttaactacggcgtgagcttcccgatgtttgagaaagtggacgtcaacggc
cccgccgcacacccgctgtttcgttatctgaaacaagcgttgcccggcgtgctcggcgga
cggatcaagtggaatttcaccaagttcctcatcggtcgcgacggcacacccctcacgcgt
tttgcgccgttcacgacgccggagaaaatggaagcctccattgtcgcggccctcacgcgc
tga

DBGET integrated database retrieval system