KEGG   Klebsiella pneumoniae 32192: KU54_019820Help
Entry
KU54_019820       CDS       T03746                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00052  Galactose metabolism
kpne00500  Starch and sucrose metabolism
kpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KU54_019820
   00500 Starch and sucrose metabolism
    KU54_019820
Enzymes [BR:kpne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KU54_019820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJB58918
UniProt: W9BE89
Position
3926518..3927918
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYAPQTMQADDGRRLLVGWMGV
PDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELVALRGEAQGWCGQTLPLAPM
ELAFDIAPNSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgtctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcaacggactgctgaac
gatcctaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgcgaccatacctataagtgctggggacactggagctctgccgatctgctgcac
tggcggcacgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tctggcagcgcggtcgagttcgagggtgccctgactctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgcaccgcctggcaatgtctggcgaccgagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctgccagaaggctataccggccatgtgcgcgac
cctaaagtgtggcggcaggacgggcgctggtacatggttcttggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggagtggcgcctggtgggc
gagatcgccgggcacgacgtgaacggcctggcgaacgccggctacatgtgggagtgcccg
gatctctttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacgcgggatcttcgaccacggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgcaggccgacgatggccgccgcctgctggtcggctggatgggcgtc
cccgacggggacgagatgcatcagcccacccgcgcgcagggctggatccatcagatgacc
tgcgtgcgtgagctggagtggcaggctggcactctgtatcagcgtccgctgcgcgagctg
gtcgccctgcgcggggaagcccagggctggtgcggacagaccctgcccctcgccccgatg
gagctggcctttgacatcgcccccaacagcacgctggggctggactttgccggcgccctg
cagctcaccgtcaatcgcgacggtctgcgtctgtcgcgccgcggcctgcagacggcggag
atgcatcaccgctactggcgcggcgaggcgcgccgcctgcggatctttatcgaccgctcc
agcgtagagattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system