KEGG   Klebsiella pneumoniae 32192: KU54_023070Help
Entry
KU54_023070       CDS       T03746                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00230  Purine metabolism
kpne00240  Pyrimidine metabolism
kpne00760  Nicotinate and nicotinamide metabolism
kpne01100  Metabolic pathways
kpne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KU54_023070
   00240 Pyrimidine metabolism
    KU54_023070
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KU54_023070
Enzymes [BR:kpne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     KU54_023070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AJB59523
UniProt: A0A081M2A0
Position
complement(4577336..4578013)
Genome map
AA seq 225 aa AA seqDB search
MKWDWIFFDADETLFTFDSFSGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITS
LQLQHQRFDSWAGRLNVPPGELNDAFMNAMAEICAPLPGAVSLLNALQGKVRMGIITNGF
TSLQQTRLERTGLRDHFDLLIISEQVGVAKPDARIFDYALAQAGNPPRSRVLMVGDTAES
DIRGGVNAGLATCWLNAHQRELPADLEPDWTVTSLSELEQLLCKH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgggactggattttctttgatgccgatgaaacgctgtttacgtttgattctttc
agcggcttgcagcggatgtttctcgactacagcgtgacctttaccgccgaagattttcag
gactatcaggccgtgaacaagccgctatgggtggattaccaaaacggcgccatcacctcg
ctacaattacagcatcagcgttttgatagctgggcgggacgtttgaatgtgccgcccggg
gaactcaacgacgcgtttatgaatgcgatggcggaaatctgtgccccgttgccgggcgcg
gtctcgctgctcaacgcgctgcagggcaaggtcagaatgggcatcatcaccaacggcttt
acctcgctgcagcagactcgtctggagcggacaggtttacgcgatcactttgatttgctg
attatttctgaacaggtgggtgtcgccaagccggacgcgcgtattttcgattatgcgctg
gcgcaggcgggtaacccaccgcgctcgcgggtgctgatggtcggcgataccgccgagtcg
gatattcgcggcggcgtgaacgccggactggcgacctgctggctcaatgcgcatcagcgc
gagctgccagcggacctcgagccggactggacggtgacctcgttaagcgaactggagcag
ctcctgtgtaaacactga

DBGET integrated database retrieval system