KEGG   Klebsiella pneumoniae 32192: KU54_025390Help
Entry
KU54_025390       CDS       T03746                                 

Definition
(GenBank) PTS friuctose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00051  Fructose and mannose metabolism
kpne01100  Metabolic pathways
kpne02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KU54_025390
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KU54_025390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpne02000]
    KU54_025390
Enzymes [BR:kpne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     KU54_025390
Transporters [BR:kpne02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    KU54_025390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AJB59954
UniProt: W9BK71
Structure
PDB: 

Position
5019881..5020375
Genome map
AA seq 164 aa AA seqDB search
MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNVV
SLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAV
SLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaccctcgcccgtattgatgaccgactgattcatggccaggtcaccaccgtg
tggtcaaaagtcgccaacgcccagcggataattatctgcaatgacgatgtatttaacgat
gaggttcgccggaccctgttgcgccaggcggctccgccaggcatgaaggtaaacgttgtc
agtctggaaaaagcggttgcggtctatcataacccgcaatatcaggacgagaccgtcttt
tatttatttaccaatccacacgatgttttaacgatggtgcgccagggcgtgcagatcgcc
acgttaaatattggtggcatggcctggcgacccggtaaaaaacagctaaccaaagccgtt
tctttggatccgcaggatattcaggcattccgtgaactcgataaactgggcgtaaaactc
gatttacgcgtggtcgcatcagatccgtcagtcaatattctcgacaaaattaacgaaaca
gctttctgcgaataa

DBGET integrated database retrieval system