KEGG   Klebsiella pneumoniae 32192: KU54_026540Help
Entry
KU54_026540       CDS       T03746                                 

Definition
(GenBank) iron ABC transporter substrate-binding protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00010  Glycolysis / Gluconeogenesis
kpne00030  Pentose phosphate pathway
kpne00051  Fructose and mannose metabolism
kpne00680  Methane metabolism
kpne01100  Metabolic pathways
kpne01110  Biosynthesis of secondary metabolites
kpne01120  Microbial metabolism in diverse environments
kpne01130  Biosynthesis of antibiotics
kpne01200  Carbon metabolism
kpne01230  Biosynthesis of amino acids
Module
kpne_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KU54_026540
   00030 Pentose phosphate pathway
    KU54_026540
   00051 Fructose and mannose metabolism
    KU54_026540
  09102 Energy metabolism
   00680 Methane metabolism
    KU54_026540
Enzymes [BR:kpne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     KU54_026540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: AJB60146
UniProt: W9BCU0
Position
complement(5255598..5256440)
Genome map
AA seq 280 aa AA seqDB search
MSLYNFNEILKIAQERDFKAIGSFNLHCIEMLPAFFKAAQNSRSPLMIQISTGTAEYLGY
RLLVDAVRSLADSENIPTCLHLDHCSDIKAIETAMNAGFSSVMYDGSHLSLEENIGNTRI
VVEMARPRNITVEGELGAIGGSEDGKAVAAEDICFTTVEDATRFVKETQVDMLAVSVGTV
HGLYTGKAQIQHARLKAISEATGVPLVLHGGTGVSDEDMRLAVTEGINKVNVGTEMNVQW
VDRCKSTFEKGKVNDSVRKFLIPANQAVTAVLMEKMALFK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtataattttaatgagattttaaaaatcgctcaggaaagagattttaaagcg
attggctcgtttaacttgcactgtattgagatgttaccggctttttttaaagccgcgcaa
aacagccgcagcccattaatgatccaaatatcaaccggtaccgcagagtatctggggtat
cggttactggtcgatgccgtgcgttcattagcagacagtgaaaatatcccgacctgcctg
catctcgatcactgctccgatattaaagccatcgagacggcaatgaatgcgggcttttct
tcggtgatgtacgacgggtctcacttaagcctcgaggaaaatatcggtaacacgcggatt
gtggtggaaatggcccggccgcggaatattacggtagaaggtgagctgggggcgatcggc
gggtcagaggatggaaaagcggtggctgccgaagatatctgttttactaccgtcgaagac
gcgacgcgttttgtgaaggagacacaggtcgatatgctggccgtctccgtgggcactgtg
catggcctgtacaccggtaaagcgcagatacagcatgcgcggctgaaggcgataagcgaa
gcgacgggcgtgccgctggtgctgcatggcggcacaggtgtcagcgatgaggatatgcgg
ctggccgtcaccgaagggattaataaagtgaacgtcggaacggaaatgaacgtgcagtgg
gtcgaccgctgtaaatcaacgtttgagaaaggaaaagtaaatgacagcgtacggaaattt
ttaattcccgccaaccaggcagttactgccgtattaatggaaaaaatggcgctatttaag
tag

DBGET integrated database retrieval system