KEGG   Klebsiella pneumoniae 32192: KU54_026625Help
Entry
KU54_026625       CDS       T03746                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00010  Glycolysis / Gluconeogenesis
kpne01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KU54_026625
Enzymes [BR:kpne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     KU54_026625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_PPase PerC SHOCT TrmB PNK3P
Motif
Other DBs
NCBI-ProteinID: AJB60163
UniProt: A0A060VLW2
Position
complement(5270562..5271161)
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLATLKQHFTMGEAFHQHERGELSDEDFAAA
MCHEMNMPLSYEQFAHGWQAVFVALRPEVITIMHKLRAQGHRVVVLSNTNRLHTTFWPDE
YPEVRAAADRIYLSQEMGLRKPEAQIYLRVLEEEGFSAADTVFFDDNVDNIAGANRLGIT
SILVTGKETIPDYFAKQLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgacattgacttcaaccgggtattg
ggagcctggagcgatttaacccgcatcccgctggcgacgctgaagcagcatttcaccatg
ggtgaggctttccatcagcatgagcgcggcgagctcagcgatgaagactttgccgccgcc
atgtgccatgaaatgaatatgcccctcagctatgaacagtttgctcacggctggcaggcg
gtgtttgtcgcgctgcgcccggaggtgattaccatcatgcataaacttcgtgcccagggg
catcgggtggtggtgctctccaataccaatcgtctgcacaccacgttctggcccgatgaa
tacccggaagtgcgcgcggccgccgatcgcatttatctgtcgcaggagatgggattgcgt
aagcctgaagcgcaaatttatctgcgagtactggaagaagaggggttttccgccgcggat
acggtcttttttgatgataacgtcgataatatagcaggggccaaccggttggggatcacc
agtatcctggtgactggtaaggagaccatccctgactatttcgcgaaacagctatgctaa

DBGET integrated database retrieval system