KEGG   Klebsiella pneumoniae Kp52.145: BN49_0168Help
Entry
BN49_0168         CDS       T05281                                 

Gene name
mtlD
Definition
(GenBank) highly similar to mannitol-1-phosphate 5-dehydrogenase from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp|A6TFJ4)
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00051  Fructose and mannose metabolism
kpnk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN49_0168 (mtlD)
Enzymes [BR:kpnk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BN49_0168 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CDO11936
UniProt: W9BBE6
Position
complement(173370..174518)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIELTFADVNQTVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDEVVDLIAEVDLVTTAVGPVVLERIAPAIAKGLAQRKAQGTERPLNIIAC
ENMVRGTTQLKGHVFNALAEEDKAWVEAHIGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVQGAMEESGAVLIKRYAFDPQKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDAASDVVAEAVNDYNAEK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggacgtggctttatcggtaaattgctg
gccgacgcgggcatcgaactgacgtttgccgatgtcaatcagaccgtacttgatgccctg
aatgcccgtcatagctatcaggttcacgtcgtcggtgagaatgagcaggtggacaccgtc
tccggcgtcaatgccgtcagcagcatcggcgatgaggttgtggacctgatcgctgaggtg
gatctggtcaccaccgccgtcggtcccgtcgtgctcgagcgcatcgcgccagcgatcgcc
aaagggctggcgcagcgcaaagcgcagggcaccgaacgcccgctgaacatcatcgcctgc
gaaaatatggtgcgcggcaccacgcagttaaaaggccacgtgtttaacgcgctggcggaa
gaagataaagcgtgggtggaagcgcatatcggctttgtcgactctgccgttgaccgtatt
gtgccgccatcggcttccgccactcatgacccgctggaagtcaccgtggaaacctttagc
gaatggattgtcgataagactcagttcaagggcgcgctgccgactatcccgggaatggaa
ttaactgataacctgatggcatttgtcgaacgcaagctcttcaccttgaacaccgggcat
gctataaccgcctacctcggaaaactggcgggccatcagacgattcgcgacgcgatcctc
gacgagaaaattcgtgccgtcgtgcagggcgcgatggaagagagcggcgcggtgctgatc
aaacgttacgcctttgacccgcagaagcacgcggcttatatccagaaaatacttggccgt
ttcgagaacccgtacctgaaagacgatgttgagcgcgttggccgtcagccgctgcgcaaa
ctgagcgctggcgaccgtttaattaagccgctgctgggtacactggaatacgggctgccg
caccgcaacctggtgaaagggattgcggcggcgatgcatttccgtagcgaagacgatccg
caggcgcaggagctggcggcactgatcgccgacaaggggccgcaggccgcgctggcgcag
atttccggcctggatgccgcaagtgatgtcgtcgcggaggccgttaacgactacaacgcg
gaaaaatga

DBGET integrated database retrieval system