KEGG   Klebsiella pneumoniae Kp52.145: BN49_0483Help
Entry
BN49_0483         CDS       T05281                                 

Gene name
dcoA
Definition
(GenBank) highly similar to oxaloacetate decarboxylase alpha chain from Klebsiella pneumoniae (sp|P13187)
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00620  Pyruvate metabolism
kpnk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN49_0483 (dcoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpnk02000]
    BN49_0483 (dcoA)
Enzymes [BR:kpnk01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BN49_0483 (dcoA)
Transporters [BR:kpnk02000]
 Other transporters
  Primary active transporters [TC:3]
   BN49_0483 (dcoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA ADH_zinc_N F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: CDO12244
UniProt: W9B294
Position
504441..505904
Genome map
AA seq 487 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQAALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTQYDTGLDIHRLENIAAYFREVRKKYHAFEGQLKGTDSRILVSQVPGGML
TNLEGQLKQQSAAHRLDDVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLGGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAALEADVRRQAQEK
GITLAENAIDDVLTVALFPQIGLKFLENRHNQAASEPEPQPEAAQPQAKAEKRAASGVYT
EEVEGKA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgccacc
cgtctgcgtctcgacgatatgctgcccgttgccgctcagctggacgacgtcggctaccgc
tcgctggagtgctggggcggcgccacctttgacgcctgcatccgctttctcggcgaggac
ccgtgggtccgcctgcgcgagctgaaaaaggcgatgcccaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgacgacgtggtggagcgcttc
gtggagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgac
ccgcgcaacatgcaggccgccctgcaggcggtccgccgccacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcccacaccctgcagacctggctcgacctcaccgaa
cagctgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaaaaaacgctacgacgtcaccctgcac
ctgcactgccatgccaccaccgggatggcggagatggccctgctgaaggccattgaagcc
ggggtcgacggcgtcgacactgccatctcctcgatgagcgccacctacggccacccggcc
accgaggcgctggtcgccaccctcgccggcacgcaatatgacaccgggctggatatccac
aggctggagaacatcgccgcctacttccgcgaggtgcgcaaaaaataccacgccttcgaa
ggccagctgaaaggcaccgacagccgtatcctggtgtcccaggtgccgggcgggatgctc
accaacctcgaaggccagctgaagcagcagagcgccgcccaccgtctggatgacgtgctg
gcggaaatcccccgcgtgcgcgaggacctcggcttcatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtgctgggcggcgagcgctacaaaaccatc
gcgaaggagaccgccggtatcctgaaaggcgagtacggccgcaccccggccccggtgaac
gccgccctgcaggcgcgggtgctcgacggcgccgacccggtgacctgccgcccggcggat
ttactcaagccggagctggccgcgctggaagccgacgtcagacgccaggcgcaggagaag
ggcatcacgcttgccgaaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctgaagttcctcgaaaaccgccacaaccaggcggcctctgagccggaaccgcag
ccggaagccgcacagccacaggcaaaagcagaaaaacgtgccgcctccggcgtctacacc
gaggaggtggaaggcaaagcctaa

DBGET integrated database retrieval system